SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005370 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000005370
Domain Number - Region: 87-250
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00907
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005370   Gene: ENSSSCG00000021709   Transcript: ENSSSCT00000005507
Sequence length 280
Comment pep:novel chromosome:Sscrofa10.2:1:194948369:194953988:1 gene:ENSSSCG00000021709 transcript:ENSSSCT00000005507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLFEEIKASIKNNYNQDRSFWRPVLPWGGVFTIKAGRKAVSCTPLYVEIRLKNTCTID
GFLMLLYVILNENENFPRELSLHLGREFVDCFLYLMDTYSFTTVKLLWIWDKMEKQQYKS
EVHKASLIIDLFGNEHDNFTKNLENLMSTIQESYCSNWRCPTRVQEDQQRTINIKCGGLR
EFSQRVFCHGAPPFVVLNMQHWKSEDLAYVPYYLDLSDHKYLLEGATLFNKEEHHYSAAF
QIDGHWMHYDGLRNVNLILLNKPPEFLLLSSLVYIRATEK
Download sequence
Identical sequences E2QSB8 Q2KIN3
ENSBTAP00000047138 ENSSSCP00000005370 ENSSSCP00000005372 ENSCAFP00000032210 NP_001039906.1.59421 NP_001039906.1.76553 XP_005892647.1.15283 XP_006072837.1.26621 XP_010834414.1.44457 XP_011985504.1.54773 XP_014957503.1.66739 ENSBTAP00000047138 ENSSSCP00000005370 ENSSSCP00000005372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]