SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005403 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005403
Domain Number 1 Region: 504-701
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.49e-50
Family SPRY domain 0.0038
Further Details:      
 
Domain Number 2 Region: 439-533
Classification Level Classification E-value
Superfamily Fibronectin type III 4.04e-17
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 3 Region: 221-284
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000201
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 2-51
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000442
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000005403
Domain Number - Region: 164-198
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0481
Family TFIIH p44 subunit cysteine-rich domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005403   Gene: ENSSSCG00000005025   Transcript: ENSSSCT00000005541
Sequence length 710
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:201010807:201116301:-1 gene:ENSSSCG00000005025 transcript:ENSSSCT00000005541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEMEEELKCPVCGSFYREPIILPCSHNICQACARNILVQTPESESPQSRRASGSGVSDY
DYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPV
PRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATV
MCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMY
CVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRN
MVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKL
RQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNS
PLLQSIHQLDFVQMKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPAEGYILELD
DGNGGQFREVYVGKETMCTVDGLHFNSTYNARIKAFNKTGVSQYSKTLVLQTSEVAWFAF
DPGSAHSDIIFSNDNLTVTCSSYDDRVVLGKTGFSKGVHYWELTVDRYDNHPDPAFGVAR
IDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKTLTF
FINDEQQGPVAFDNVEGLFFPAVSLNRNVQVTLHTGLPVPDFYSSRASIA
Download sequence
Identical sequences F1SFF7
ENSSSCP00000005403 9823.ENSSSCP00000005403 XP_001928246.3.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]