SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005408 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005408
Domain Number 1 Region: 530-754
Classification Level Classification E-value
Superfamily GFP-like 1.99e-85
Family Domain G2 of nidogen-1 0.000000652
Further Details:      
 
Domain Number 2 Region: 1117-1374
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-43
Family YWTD domain 0.000000271
Further Details:      
 
Domain Number 3 Region: 905-1016
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 7.19e-22
Family Thyroglobulin type-1 domain 0.0004
Further Details:      
 
Domain Number 4 Region: 1022-1092
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 7.85e-20
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 
Domain Number 5 Region: 487-527,765-862
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-19
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 854-913
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000115
Family EGF-like domain of nidogen-1 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005408   Gene: ENSSSCG00000005030   Transcript: ENSSSCT00000005546
Sequence length 1385
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:201971913:202044999:-1 gene:ENSSSCG00000005030 transcript:ENSSSCT00000005546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLLLLLSRAVALQPDELFPYGQSLGDQLLQEGDDESSAAVKLALPLRFYDAQFSDLYVR
GQCSVDLTEPLPSETRCEDNDNQTHFERNGSPLALRMSSHGGPRILGELGTGDPFVGLGS
SYLKPGFLLSDRSCLRRSGGFLGTGKHKQLCRGVQWGNSGAGQLNTFQAVLASDESDTYA
LFLYPANGLQFFGTRPKESYNVQLELPARVGFSRGEVDDLKREEQYFSLTSTEQSVKNLY
QHSNLGIPGVWAFHIGSASPLDNVKPAIAGGDLSKAHPSVPLRHSSSHAVAPEGEDTEDN
LDYYDENEEEVEYPPGETEEESNGHSPDDVSFHSRADLKPSGGGISLPGSDLPSPLPRPT
SRDGLETESATLDPQTKEGRPQEEIDAPDLKGRGETSEQPGAQVPAPPKTERDSPDPSWA
ALPPHPDEGALPAERDVPPVPSGGEVVLPNYPRRPDHAPPLGRGRQVVGVEDDIGSNTKV
FTYNAANRETCEHNHERCSRHAFCTDYATGFCCHCQSRFYGNGKHCLPEGAPHRVNGKVS
GHLLVGHTPVHFTDVDLHAYVVGNDGRAYTAISHIPQPAAQALLPLMPIGGLFGWLFALE
KPGWENGFSLTGATFIHDMEVTFHPGGERVRITQTAEGLDPENYLSIKTNIQGQVPYIPA
NFTVHITPYKELYHYSGSAVTSTSSRAYSLTYGAINQTRSYSIHQNITYQTCRHAPRHWA
IPTTQQLNVDRVFALYTDEEKVLRFAVTNQIGPVEGDSEPAPVNPCYDGSHTCATTAQCH
PATGVDYTCECASGYQGDGRRCVDVNECATGFHRCGPNSVCVNLPGSYRCQCRSGYEFVD
DRHTCVLIAPPPNPCEDGSHNCAPTSQARCIHHGGRSFSCACLPGYAGDGHQCADVDECS
ENRCHPSATCSNTPGSFSCHCQPGYHGDGFQCTPVWSPEDPALGLKPCEHQQREAQAQRT
HPGARLHIPQCDEQGHFLPLQCHGSTGFCWCVDPNGQEVPGTRTPPGSLPPHCGPPGEPT
QRPRTVCERWRESLLEHYGGTPRDDQYVPQCDDLGHFTPLQCHGKSDFCWCVDQDGREVQ
GTRSQPGTTPACIPTVAPPTMRPTPRPDVTPPPVGTFLLYAQGQQIGHLPLNGTRLQKDM
AKTLLSLHVTKGSIVVGIDYDCRERMVYWTDVAGRTISRASLEPGAEPETIVNSGLISPE
GLAIDHFRGTMYWTDSGLDKIERARLDGSERRALFHTDLVNPRAIAVDPIRGNLYWTDWN
REAPKIEMSSLDGENRRILVNKDIGLPNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRR
VIQNNLNYPFSIVSYADHFYHTDWRRDGVISVNRDSGQFTDEYLPEQRSHLYGITAVYPY
CPTGK
Download sequence
Identical sequences ENSSSCP00000005408 ENSSSCP00000005408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]