SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005708 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005708
Domain Number 1 Region: 121-371
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.09e-79
Family Carbonic anhydrase 0.000000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005708   Gene: ENSSSCG00000005315   Transcript: ENSSSCT00000005853
Sequence length 442
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:264119361:264126033:1 gene:ENSSSCG00000005315 transcript:ENSSSCT00000005853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPQCPSPWLPLLIPAPAPGPTVHLLLLLLLLVPAHPQSMSWMQGAPTTGGDSSGEDDPL
EEDLPSEEDIPGEEDQPGMKTEPGEENSLNLEDLPTTEAPRDTQGPQKNVHREKKGDDHS
HWRYGGAPPWPQVSPACAGRFQSPVDIRPQLTAFCPALRPLELLGYELPPQPELRLRNNG
HTVQLSLPPGLELSLGPGQEYRALQLHLHWGSAGRPGSEHTVGGYRFPAEIHVVHLSTAF
AKIDEALGRPRGLAVLAAFLQEGPEENSAYEQLLSHLGEIADEDSETWVPGLDVSALLPS
DLNRYFRYEGSLTTPPCAQGVVWTVFNETVKLSAKQLHTLSDSLWGPDDSRLQLNFRATQ
PLNGRIIEASFSTEVDSSPRAVEPVHLNSCLAAGDILALVFGLLFAVTSVVLLVQMRRQQ
RHSSGTKGGVSYHPAEVTETVA
Download sequence
Identical sequences XP_001925555.2.46622 ENSSSCP00000005708 9823.ENSSSCP00000005708 ENSSSCP00000005708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]