SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005754 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005754
Domain Number 1 Region: 29-512
Classification Level Classification E-value
Superfamily ALDH-like 3.53e-185
Family ALDH-like 0.00000000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005754   Gene: ENSSSCG00000005361   Transcript: ENSSSCT00000005901
Sequence length 517
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:267166211:267167764:1 gene:ENSSSCG00000005361 transcript:ENSSSCT00000005901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHFLVPRLFGLCRPVAPYSSAAALPSPILNPDIRYNQLFINNEWQDAVSKKTFQTVNPT
TGEVIGHVAEGDQADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLA
SLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCG
QIIPWNFPLVMQAWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEVGFPPGVVNILTG
YGPTAGTAIAHHMDVNKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADM
DHAVEQCHEALFFNMGQCCCAGSRTFVEESIYDEFLERTVEKAKRRKVGNPFELDTQQGP
QVNKEQFERILGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP
VQPLFKFKRIEEVIERANNTRYGLAAAVFTQDLDKAMYFTQALQAGTVWVNTYNIVTCHT
PFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKDS
Download sequence
Identical sequences F1ST54
ENSSSCP00000005754 XP_003353634.1.46622 ENSSSCP00000005754 9823.ENSSSCP00000005754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]