SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005767 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005767
Domain Number 1 Region: 262-438
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-52
Family SPRY domain 0.00018
Further Details:      
 
Domain Number 2 Region: 24-80
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000143
Family B-box zinc-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005767   Gene: ENSSSCG00000005374   Transcript: ENSSSCT00000005914
Sequence length 445
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:268088218:268114635:-1 gene:ENSSSCG00000005374 transcript:ENSSSCT00000005914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAAALSGTPEGLGRGDPEEAHGRRCREHGDRVAELFCRRCRRCVCALCPVLGAHRGHP
VCLVLEEAARVQNLTQECLMQLASKKQQQVGNITQIEDAAEKLKAHAESSKTWLTGKFTE
LRLLLDEEEALAKKFIDKNTQLALQVYREQIESCGEQINVMNSLSDKVWSISQERNPIQL
LQEYMAAEQQIQQQLSLGELCHPMPLSFEPVKSLFKGLVDAMQSLLQTPLDVRLKEDMNC
QLSGSSSAKPGSLLKTSPSPQRSLFLKYARTPTLEPDTMHARLRLSADRLTVRCGLFGRL
GPTPTLCFDSLWQVLGRDCFAAGRHYWEVDVQEAGIGWWVGAAYGSLRRRGASAAARLGC
NRQSWCLKRYDLEYWAFHDGQRSRLRLRDDPDRLGVFLDYEAGVLAFYDVSGGMSHLHTF
RAAFQEPLYPALRLWEGAISIPRLP
Download sequence
Identical sequences A0A287B0V1
9823.ENSSSCP00000005767 ENSSSCP00000005767 ENSSSCP00000005767 XP_003122079.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]