SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005796 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005796
Domain Number 1 Region: 518-538,578-681,795-910
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.84e-46
Family Phosphate binding protein-like 0.000036
Further Details:      
 
Domain Number 2 Region: 117-500
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000918
Family L-arabinose binding protein-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005796   Gene: ENSSSCG00000005400   Transcript: ENSSSCT00000005943
Sequence length 1116
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:271878065:272030735:-1 gene:ENSSSCG00000005400 transcript:ENSSSCT00000005943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLSLWWLLSRVCLLLPPPCALVLAGVPGSSSHPQPCQILKRIGHAVRVGAVHLQPWTT
APRAARRIPDSSRTGAQRDEPQPGTWRPPAPSPGARWLGSALHSRGPPGARKLGGGAGAE
TLWPRDALLFAVDNLNRVEGLLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSF
LQSVCHTVVVQGVSALLAFPQSLGEMMELDLVSSVLHIPVISIVRQEFPRESQNPLHLQL
SLENSLSSDADVTVSILTMNNWYNFSLLLCHEDWNITDFLFLTQNNSKFHLGSIINITTN
FSSTEDLLSFLQAQLESIKNSRPQFLLFVCSSDYFLSIFSNLALAGIIKPPLLLSLKNGT
NLLHARYSHLPLQNLCHWTILAKFFEFVPPSVSLNDYLLALAGIIKPPLLLSLKNGTVLN
CGEADTTGVCSGERGRKMFLANTTFRGLSGSIRVKGSTIISSENNFFIWNLQHDPMGKPM
WTRLGSWQGGKIVMDYGIWPEQAQRHRTHFQHPSKLHLRVVTLIEHPFVFTREVDDEGLC
PAGQLCLDPMTNDSSMLDSLFNSLHSGNDTVPIKFKKCCYGYCIDLLEKLSEDMNFDFDL
YIVGDGKYGAWKNGHWTGLVGDLSGSAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVR
TRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSS
ALNVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELS
GIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATLDGVEYLKNDPEK
LDAFIMDKALLDYEVSVDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHG
FMDVLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYWL
LLPRIKNKSRLQYWLHTSQRLHRALNTSFVEEKQQRFKTKRVEKRSNMGPRQLAVWNTSN
LSHDQRRKYIFSDEGGQNQPGLRTHHDIPLPQRGELPASLTTNGKAASLNGARNSVMQEL
SELEKQIQVIRQELQLAMSRKTELEEYQRTNRTCEP
Download sequence
Identical sequences ENSSSCP00000005796 ENSSSCP00000005796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]