SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005821 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005821
Domain Number 1 Region: 328-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-34
Family SPRY domain 0.00078
Further Details:      
 
Domain Number 2 Region: 157-267
Classification Level Classification E-value
Superfamily Fibronectin type III 2.09e-16
Family Fibronectin type III 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000005821
Domain Number - Region: 8-116
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00129
Family Formin homology 2 domain (FH2 domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005821   Gene: ENSSSCG00000005426   Transcript: ENSSSCT00000005969
Sequence length 502
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:276477079:276534946:1 gene:ENSSSCG00000005426 transcript:ENSSSCT00000005969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEGMVEALQRIITTLANKNDEIQNFIDTLNQTLKGVQENSSNILSELDEEFDSLYSILDE
VKESMVNTIKQEQARKSQELQSQLSQCNNALENSEELLEFATRSLDIKEPEEFSKAARQI
KDRVTMASSLEHNWKDKVSHETQMEIVRVVTKRNMFMAVLILSVPKAPEIDPVECLVADN
TVTVAWKMPEEDNKIDHFILEYRKTNFDGLPRVKDERCWEIIDNIKGTEYTLSGLKFDSK
YMNFRVRACNKAVAGEYSDPVTLETKALNFSLDNSSSHLNLRVEDTCVEWDPTGGKGQES
KIKGKENKGRTKRPKKKKRSGTPSPKRTSIGSRPPAVRGSRDRFTGESYTVLGDTAIESG
QHYWEVKAQKDCKSYSVGVAYKTLGKFDQLGKTNTSWCIHVNNWLQNTFAAKHNNKVKAL
DVTVPEKIGVFCDFDGGQLSFYDANSKQLLYSFKTKFTQPVLPGFMVWCGGLSLNTGMQV
PSAVRTLQKSENGMTGSASSLN
Download sequence
Identical sequences ENSSSCP00000005821 ENSSSCP00000005821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]