SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005873 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005873
Domain Number 1 Region: 10-129
Classification Level Classification E-value
Superfamily FKBP-like 2.75e-22
Family FKBP immunophilin/proline isomerase 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005873   Gene: ENSSSCG00000005477   Transcript: ENSSSCT00000006023
Sequence length 1044
Comment pep:known chromosome:Sscrofa10.2:1:284601552:284640254:-1 gene:ENSSSCG00000005477 transcript:ENSSSCT00000006023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFILQVCIAKCNSTSSLDSVLSQDLVVTEGPAVEVGDSLEVAYTSWVFQNHTLGQVLDST
ANKDKLLRLKLGSGKVIKGWEDGMVGMKKGAKRLLFIPPACAAGSEGVIGWSHSTDSILV
FEVEIRRVKFARDAGSDGHSVSSRDSAAPSPVPGVDNISADPVVSPSTSVPFKSGESALR
SKSNSLSEQLTMNTNPDTVKAKLISRMAKMGQPMLPILPPQLDSNDSEIEDVNALRGAGQ
PLGTLPIQPSLQPAHPALPQMTSQAPQPSVSGLQTPSAALMQVASLDSHSAVSGNAQSFQ
PYAGMQAYAYPQAPAVTSQLQPVRPLYPAPLSQSPHFQGSGDVASFLMTEARQHNTEIRM
AVSKVADKMDHLMTKVEELQKHSAGNSLLLPGMSVTMETSMIMSNIQRIIQENERLKQEI
LEKSSRIEEQNDKISELIERNQRYVEQSNLMMEKRNTSLQTATENTQARVLHAEQEKAKV
TEELAAATAQVSHLQLKVAAHQKKETELQMQLTESMKDTDLLRSQLAKVQAELSELQETS
EQAQSKFKSEKQSRRQLELRVTSLEEELTDLRAEKESLEKNLSERKKKSAQERCQAEEEI
DEIRKSHQEELDKLRQLLKKARVSTDQAAAEQLSLVQAELQSQWEAKCEHLLASAKDEHL
QQYQEVCAQRDASQQKLLQLEAKCSALQAQVTALKEQNAQHLKDLENKPQVSGVEAATAD
PSEKVKKIMNQVFHCLRGEFELEESYNGRTILGAIMSTIKMVTLELLDQHEREKGESSNE
EEEEEERPRSPAQEPSISVSARQSQAPSHREKQEPPTVPTEQVVQEAAALPPQALPTPQD
DVQGRDGEPSEAEALSEIKEDASPPEPACLASHRALRPPTSIPPKPPGPVTVDSECEEAL
APSSLGGAFVGEQESSRRLSLTLDSKKGDPLALGPESPEGEPRAPELKNEEGVTSTPAPS
QEPCSPEAASSAVGATAGSSHCSQQPSLCEDEDDELFKGATLKVASPKAQAEEEDDDEVS
MKGRPPPTPLFGDDDDDDDIDWLA
Download sequence
Identical sequences ENSSSCP00000005873 ENSSSCP00000005873 9823.ENSSSCP00000005873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]