SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005883 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005883
Domain Number 1 Region: 48-243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.28e-29
Family Laminin G-like module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005883   Gene: ENSSSCG00000005487   Transcript: ENSSSCT00000006033
Sequence length 1869
Comment pep:novel chromosome:Sscrofa10.2:1:285795979:286174228:1 gene:ENSSSCG00000005487 transcript:ENSSSCT00000006033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTNAVRRPRKDRPSSLAPRDPVSRGFLFIWILVSLACHLASAQGAPEDVDVLQRLGLSW
TKAAGGRSPPPPGVIPFQSGFIFTQRARLQAPTTAVIPATLGPELALVLSLCSHRVNHAF
LFAVRSRKHKLQLGLQFLPGKTVVHLGPRRSVAFDLDVHDGRWHHLALELRGRSVTLVTA
CGQRRVPVSLPFHRDPALDPEGLFLFGKMSPHAVQFEGALCQFSIYPVTRVAHNYCTHLR
KQCGQADTYRPQLGPFLPRDSGTPLTFQTDLALLGLENLTTATPALGSQPAGRGPRVTVV
PATPAKPLRTSTTGPHQPVTVEGPSHTPLPPSKLSTTELPPMSPASPASSTRPVQPVLKS
TATQIPKSHPAKPSALSPSTVPVKSPHPTLKAAPPSFTKPAPPTKKLPTSQPVPTKVSRP
TVKPIQRHPVTPRPPPPSARPLPPATTGSSKKPFPPVVRAEAKMSGRASELAPARTSTHK
PPQPTGLPPSPAPSPVSTRTPRPPATVVPPTLAPGSAPTGSKKPTGSEATKKAKPKSSPR
KPAPPRPGKATRDVPLKDPTPGPSPRHPRPSRQTTPAPVLAPARFLSSSPRPMSTGYSFF
HLVGPTPFLLLMGPPGPKGDCGLPGPPGLPGLPGPPGARGPRGPPGPYGNPGLPGPPGAK
GQKGDPGLSPGKAHDGAKGDVGLPGLLGNPGPLGRKGYKGYPGPAGHPGEQGPPGPEGSP
GAKGYPGRQGLPGPVGDPGPKGSRGYIGLPGLFGLPGSDGERGLPGVPGKRGKMGRPGFP
GDFGERGPPGLDGNPGELGLPGPPGVPGLIGDMGALGPIGYPGPKGMKGLMGNVGEPGLK
GDKGRRGVPTLSPGLGWAARPQKPHTIPIKPSGTPPPGPPGKACNKHALAWPGCPGPHLL
PSGSNPLGLGGSLQPPQPEGVKGREGRKTIRGRAHPLTPTRPSGPCYHAGVGGAKTEPGR
ELWQGSLSGGRRQAGSSQRPGGVVGVKGLMGFVNSQGPPGSLLKAVGKEGQRGRVGPPGP
QGPSWSLGFGGGPGSWGCGGKPGSWGPQGRGEARVRPPGVQGLQFHWRPKGPNSGVPKGD
SMTQSLGGGVGPRAMPGEERKEGQKGEKGHIKRKYGRGRPGIVEMPWVQGVPGKDRERGG
SHPAGSRGEQCWLDSQGPSGSKGAAGSQGASHALYDAPAQLFEGSLSKLGERGPGMEGTH
PPSHGRSVVQCAGDVGGTGDDGDGGADGVSRDGGAGGGVCVVVGPEGKPGKQGEKGRTGA
KGAKGYQGQLGEMGVPGDPGPPGTPGPKGSRGSLGPTGAPGRMGAQGEPGLAGYDGHKGI
MGPLGPPGPKGEKGEQGEDGKAEGPPGPPGDRGPVGDRGDRGEPGDPGYPGQEGVQGLRG
NPGQQGQPGHPGPRGRPGPKGSKGEEGPKGKQGKAGAPGRRGTQGLPGLPGPRGVVGRQG
PEGVAGPDGLPGLDGQAGQQGEQGDDGDPGPLGPAGKRGNPGVAGLPGAQGPPGFKGESG
LPGQLGPPGKRGTEGGTGLPGNQGEPGSKGQPGDSGEMGFPGMAGLFGPKGPPGDIGFKG
IQGPRGPPGLMEKEGIIGPLGILGPSGRQGPKGDKGSRGDLGLQGPRGPPGPRGQPGPPG
PPGSPVHFQQDDLGAAFQTWMDTSGALRAEGYSHPPDRLVLDQGGEIFKTLHYLSNLIQS
IKTPLGTKENPARVCRDLMDCEQKMVDGTYWVDPNLGCSSDTIEVSCNFTHGGQTCLKPI
TASKIFLKVGHLNLLHRFNLQGTEKAFFSVLCMVLAVPFRGSQEGQGSLTAKQAVRFRAW
NGQILKAGGQSGPEVSMDGCKVQDGRWHQTLFIFRTQDTQQLPIVSVDNLPPASSGKQYR
LEVGPACFL
Download sequence
Identical sequences ENSSSCP00000005883 ENSSSCP00000005883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]