SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005893 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005893
Domain Number 1 Region: 92-274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.99e-26
Family Clostridium neurotoxins, the second last domain 0.021
Further Details:      
 
Domain Number 2 Region: 367-486,550-623
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.17e-16
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 3 Region: 496-659
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000313
Family Reprolysin-like 0.05
Further Details:      
 
Domain Number 4 Region: 1417-1484
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000115
Family Complement control module/SCR domain 0.0052
Further Details:      
 
Domain Number 5 Region: 1348-1420
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000375
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 6 Region: 1286-1352
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000445
Family Complement control module/SCR domain 0.0043
Further Details:      
 
Domain Number 7 Region: 1216-1290
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000129
Family Complement control module/SCR domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000005893
Domain Number - Region: 683-701,883-943
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00738
Family Fibronectin type III 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005893   Gene: ENSSSCG00000005498   Transcript: ENSSSCT00000006045
Sequence length 1629
Comment pep:known chromosome:Sscrofa10.2:1:287904367:288136642:1 gene:ENSSSCG00000005498 transcript:ENSSSCT00000006045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLWSWVLRLGLLSAALGCGLAERPRRARRDPRAGRPPRPAAGPATCATRAARGRRASPP
PPPPPPGGAWEAVRVPRRRQQREARGAAEEPSPPSRALYFSGRGEQLRLRADLELPRDAF
TLQVWLRAEGGQRSPAVITGLYDKCSYASRDRGWVVGIHTVSDQGNRDPRYFFSLKTDRA
RQVTTINAHRSYLPGQWVYLAATYDGRLMKLYVNGAQVATSGEQVGGIFSPLTQKCKVLM
LGGSALNHNYRGYVERFSLWKVARTQQEVLLDMETHGLHTPLPQLLLQENWDNVKRAWSP
MKDGSSPRVEFSGAHDFLLDTSLEPPLCGQTLCDNMEVIASYNQLPRFRRPKVVRYRVVN
LHDDDHENPTVSRQQIDFQHGQLAEAFRHYNISWELEVLEVSNSSLRHRLILANCDISKI
GDENCDPECNHTLTGHDGGDCRHLRHPAFMKKQQNGVCDMDCNYERFNFDGGECCDPEIT
DVTKTCFDPDSPYRAYLDVNELKNILRLDGSTHLNIFFANSSEEELAGVATWPWDKEALM
HLGGIVLNPSFYGIPGHTHTMIHEIGHSLGLYHIFRGISEIQSCSDPCMETEPSFETGDL
CSDTNPAPKHKFCGDPGPGNDTCGFNSFFNTPYNNFMSYADDDCTDSFTPNQVARMHCYL
DLVYQSWQPSRKPAPIALAPQIVSHTTDSVTLEWFPPIDATSLKEKELGSACDLCLEGRI
LVQYAFNASSPMPCGPSGHWSPREAEGHPDVEQPCKSSVRTWSPNSAVNPHTVPPACPEP
QGCYLELEFRYPLVPESLTIWVTFVSTDWDSSGAVNDIKLLTVSGKNISLGPQNVFCDVP
LTIKLQDVGEGVYGIQIYTLDEHLEIDAAMLTSVADSPLCLECKPLQYKVVRDPPLQVDV
ASMLHFSRRFTDVDLHLGSVYQYWVITISGNEESEPSPAVIYTHGSGYCGDGIIQKSEGE
ECDDMNKVSGDGCSLFCRQEVSFNCIDEPSRCYFHDGDGVCEEFEQKTSIKDCGVYTPQG
FLDQWASNASVSHQDQQCPGWVIIGQPAASQVCRTKVIDLSEGISQHAWYPCTIPYPYSQ
VAQTTFWLRAYFSQPMVAAAVIVHLVTDGTYYGDQKQETISIQLLDTKDQSHDLGLHVLS
CRNNPLIIPVVHDLSQPFYHSQAVRVSFSSPLVAISGVALRSFDSFDPVTLSSCQRGETY
SSAQQSCVHFACEAADCPQLAVENASLNCSSSDHYHGAQCTVSCRTGYVLQIQRDDELIK
SQTGPSVTVTCTEGKWNKQVACEPVDCGIPDQHHVYAASFSCLEGTTFGRKCSFQCRHPA
QLKGNNSFLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCK
PGYHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSEC
RIKCEESDTAQGRGSNVIHCRKDGTWSGSFHLCQEMQGQCSAPDQLNSNLKLQCPEGYAI
GSECSTSCLDHNSESIILPVNVTVRDIPHWLNPTRVERVICTAGLKWYPHPALIHCVKGC
EPFMGDNYCDAINNRAFCNYDGGDCCASTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSR
KDLRGYSHG
Download sequence
Identical sequences 9823.ENSSSCP00000005893 ENSSSCP00000005893 ENSSSCP00000005893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]