SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005899 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000005899
Domain Number - Region: 211-271
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000206
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005899   Gene: ENSSSCG00000005504   Transcript: ENSSSCT00000006053
Sequence length 569
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:291412515:291465448:-1 gene:ENSSSCG00000005504 transcript:ENSSSCT00000006053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVTETRTGPLGCNSYDNLDSVSSVLLQSTESKLHLQGLQIIFPQYLQEKFVQSALSYIMC
NGEGEYVCQDSQCRCQCAEEFPQCNCPITDIQIMEYTLANMAKSWAEAYKDLENSDEFKS
FMKRLPSNHFLTIGSIHQHWGNDWDLQNRYKLLQSATEAQRQKIQRTARKLFGLSVRCRH
NPNHQLPRERTIQQWLARVQSLLYCNENGFWGTFLESQRSCVCHGSTTLCQRPIPCIIGG
NNSCAMCSLANISLCGSCNKGYKLYRGRCEPQNVDSERSEQFISFETDLDFQDLELKYLL
QKMDSRLYVHTTFISNEIRLDTFFDPRWRKRMSLTLKSNKNRMDFIHMVIGMSMRICQMR
NSSLDPMFFVYVNPFSGSHSEGWNMPFGEFGYPRWEKIRLQNSQCYNWTLLLGNRWKTFF
ETVHIYLRSRTRLPTLLRNETGQGPVDLSDPSKRQFYIKISDVQVFGYSLRFNADLLRSA
VQQVNQSYTQGGQFYSSSSVMLLLLDIRDRINRLAPPVAPGKPQLDLFSCMLKHRLKLTN
SEIIRVNHALDLYNTEILKQSDQMTAKLC
Download sequence
Identical sequences ENSSSCP00000005899 9823.ENSSSCP00000005899 ENSSSCP00000005899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]