SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005978 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005978
Domain Number 1 Region: 631-785
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.7e-18
Family Laminin G-like module 0.022
Further Details:      
 
Domain Number 2 Region: 832-1030
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-16
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 3 Region: 425-596
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-16
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 4 Region: 322-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000328
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 5 Region: 148-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000712
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 6 Region: 106-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000127
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 226-265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 8 Region: 186-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000578
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 9 Region: 360-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000753
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 10 Region: 1174-1211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000016
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 11 Region: 70-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000021
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 12 Region: 1060-1104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000495
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 13 Region: 1092-1133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000102
Family EGF-type module 0.015
Further Details:      
 
Domain Number 14 Region: 807-850
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000036
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 15 Region: 264-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000573
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000005978
Domain Number - Region: 607-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 1138-1173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0082
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 849-876
Classification Level Classification E-value
Superfamily EGF/Laminin 0.036
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005978   Gene: ENSSSCG00000005584   Transcript: ENSSSCT00000006137
Sequence length 1283
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:297889592:297910738:-1 gene:ENSSSCG00000005584 transcript:ENSSSCT00000006137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALARPGTQDLMPPVPLLLLLLLLWAPALALPTGTVPSETPGACASDPCAPGTECQATES
GGYTCGPTEPRGCASQPCHHGALCVPQDPDPNGFRCYCVPGFQGPHCELDIDECASRPCH
HGATCRNLADRYECHCPLGYAGVTCESEVDECASAPCLHGGSCLDGVGSYRCVCAPGYGG
ASCQLDLDECQSQPCAHGGVCHDLVNGFQCDCADTGFEGTRCEQEVLECASSPCAHNASC
LEGLGSFRCLCWPGYSGEWCEVDEDECASGPCQHGGQCLQRSDPTLYGGIQAAFPGAFSF
RYAAGFLCRCPLGFEGDDCSVDVDECASRPCLSGGLCQDLPNSFQCHCPDGYTGPTCQED
VNECLSEPCLHGGTCEDTVAGYICWCPETWGGHDCSVQLTGCEGHTCPLAATCIPTFKSG
VHSYTCRCPPGTHGPLCGQNTTFSVVAGNPVRAVVPAGGPLGLALRFRTTVTSGPLATRS
DTQDSLELALVGAMLQATLRSRGNNVLVLRLLDMALNDGYWHQVEVALRLGVLELRLWHE
GCPARLCMASSPVALPPLASQAPMPAGFCSSQLGGGAFAGCLQDVHVDGHLLLPEDLGEN
VLLGCGRQEQCQPPPCAHGGACVDLWTHFLCDCPRPYSGPTCADEVPAATFGLGGTLSSA
SFLLNQLPGPNLTVSFLLRTREPAGLLLQFANDSAAGLTVFLSEGQIRAEVLGSPALLLP
GRWDDGLRHLVMLSFGPDHLQSLGQQVHVGGRLFPADAQPWGGPFRGCIQDLRLNGLHLP
FFPPLLGNSSQPSAPGSRQSWNLTMGCVSEDTCSPDPCLNGGTCLVTWNDFHCTCPANFT
GPTCAQQLWCPGQPCLPPATCEEVPDGFVCVAEATFREGPPAEFSGHNASSGRALSGLSL
AFRTRDPEAGLLRAEDAPATIWLAVRNGSLAAGVRSGPSLPGAVLPAPGPRVADGAWHRV
RLAMERPEAAASRWLLWLDGAATPVALRGLAGDLDFLRGPGAARVLLAENFTGCLGRVAL
GGLPLPLARPRPGAAPGSREPFSAWPGAPAPLLGCRGAPVCVPSPCLHGGACRDLFDAVA
CACGPGWEGPRCEARADPCRSAPCARGRCHARPDGRFECRCPPGFAGPRCRLPVLPEECS
PNITCLSGAPCEGGPQGANCSCQESFAGQRCQIPCEANPCLNGGTCRAAGGVYECICSTR
FSGQFCEVVKGLPLPLPFPLLEVAVPAACACLLLLLLGLLSGIMAARKRRQSEGTYSPSQ
QEVAGARLEMDSVLKVPPEERLI
Download sequence
Identical sequences F1SKU3
XP_003122203.3.46622 ENSSSCP00000005978 9823.ENSSSCP00000005978 ENSSSCP00000005978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]