SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005988 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005988
Domain Number 1 Region: 98-285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.37e-26
Family Pentraxin (pentaxin) 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000005988
Domain Number - Region: 615-902
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000915
Family Rhodopsin-like 0.036
Further Details:      
 
Domain Number - Region: 29-62
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00542
Family C-type lectin domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005988   Gene: ENSSSCG00000005591   Transcript: ENSSSCT00000006147
Sequence length 942
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:299032504:299050804:1 gene:ENSSSCG00000005591 transcript:ENSSSCT00000006147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSLGPLPTPQVNQGTLGLQVAPLAPGEVVETANKVCKFSGQRLSWWQAQESCEQRFGHLV
LPPPDGVLAPRLPNPIWVGQRESPLRRPPQRRAHTTAALRFGERTADRAARLRKPLPALG
ALTACAHVQWDAASPDTAALFSLAVPALANALQLRAFAEPGGAVHLALVVRGHHAPFRAA
FRADGHWHHVCATWEQLGGRWALFADGRRRAGARGLGAGHPLPPGGVLVLGQDQDSLGGG
FSARDAFSGNLTDFHLWARTLSPVQLNRARSCAPPLGGLLFRWDLGALDVTPSLLPPVWV
RLFCPALPPWPVPSEECPTWDPGPRTESPLLCLQQLPFLCCYGTENYLRLQEAQSWSGQD
VISQVNALANATVLFPDPLSEEYGDLSPAEASSFLGILERVLAKEAAPLGPAALLAVVQF
LKRVAALGAWESEPGTGPWEQLGQAVVSVASLVLEEPLASAWLKVGEVVGGPMALVASVQ
RLAPLLSSVLTSERPRMHFQHRQAGLSGVTVIHSWFSSSVFKHMPGAPGQGPPAPDSSEE
TSRMQRFLSTQVGSAIISSDVWDEAGEVNTAVTFHLQHQVQSPLFPTHPSPDSGGSWATS
GCSVTALYRDSTACFCNHSTNFAILLQVYDVQRSPEDESLLRTLSFVGCGVSFCALATTF
LLFLAAGVPKSERATVHKNLTFSLASAEGFLMASEWAKDNEVACVAVTAVMHLLFLVAFS
WMLVEGLLLWSRVVAVSMRPGPRMRLYYATGWGVPVVIVAITLATSPQDYVATGHCWLNV
HTDTIWAFVGPVLFVLTANTCILVRVVIVTVSSARRRARMLSPQPCVQQQLRIQMWATVK
PVLVLLPVLGLTWLVGVLVHLSPAWAYAAVGLNSFQGPYIFLVYAAYNGEVRSALQRMTE
KKAAEAFPVERVWGGGQRQVQLSPQGLPLFLSAPGYPLSPNV
Download sequence
Identical sequences ENSSSCP00000005988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]