SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006161 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006161
Domain Number 1 Region: 28-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.77e-39
Family Laminin G-like module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000006161
Domain Number - Region: 1617-1672
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.011
Family Fibrinogen C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006161   Gene: ENSSSCG00000005751   Transcript: ENSSSCT00000006323
Sequence length 1826
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:308064163:308174334:1 gene:ENSSSCG00000005751 transcript:ENSSSCT00000006323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVHEGGLPWAPPLLLRLLQPSPCRSAQPADLLKVLDFHNLPDGITKTTGFCAARRSSKGP
DVAYRVTKDAQLSAPTKQLYPASAFPEDFSILTTVKAKKGSQAFLVSIYNEQGIQQIGLE
MGRSPVFLYEDHTGKPGPEDYPLFRGINLSDGKWHRVALSVHKKNVTLILDCKKKTTKFL
DRSDHPIIDVNGIIVFGTRILDEEVFEGDIQQLLFVSDHRAAYDYCEHYSPDCDTAVPDK
PQSQDPNPDEYYPDGEGDGDTYYYEYPYYEDTDDVGKEPSPTKTPVEAARETTEVAEEQT
QPPTSAPVPDTSEAAGKEEDPGLGDYDYVPSEDYYTPPPYEDLNYGDGLEGPDENPDQGA
RAEVPTSTVLTSNASNPAPPPEEGLDDLDTEFTEETIKNPDESYYDPYYDPTIAPSEIGP
GMPANQDTIYEGMGGPRGEKGQKGEPAIIEPGMLLEGPPGPEGPAGLPGPPGTMGPTGQV
GDPGERGPPGRPGLPGADGLPGPPGTMLMLPFRFGGGGDAGSKGPMVSAQESQAQAILQQ
ARLALRGPAGPMGLTGRPGPMGPPGSGGLKGEPGDMGPQGPRGVQGPPGPAGKPGRRGRA
GSDGARGMPGQTGPKGDRGFDGLAGLPGEKGHRGDPGPSGPPGPPGDDGERGDDGEVGPR
GLPGEPGPRGLLGPKGPPGPPGPPGVTGTDGQPGPKGNVGPQGEPGPPGQQGNPGAQGLP
GPQGAIGPPGEKGPLGKPGLPGMPGADGPPGHPGKEGPPGEKGGQGPPGPQGPIGYPGPR
GVKGADGIRGLKGTKGEKGEDGFPGFKGDMGIKGDRGEIGPPGPRGEDGPEGPKGRGGPN
GDPGPLGPPGEKGKLGVPGLPGYPGRQGPKGSIGFPGFPGANGEKGGRGTPGKPGPRGQR
GPTGPRGERGPRGITGKPGPKGNSGGDGPAGPPGERGPNGPQGPTGFPGPKGPPGPPGKD
GLPGHPGQRGETGFQGKTGPPGPPGVVGPQGPTGETGPMGERGHPGPPGPPGEQGLPGLA
GKEGTKGDPGPAGLPGKDGPPGLRGFPGDRGLPGPVGALGLKGSEGPPGPPGPAGSPGER
GPAGAAGPIGIPGRPGPQGPPGPAGEKGAPGEKGPQGPAGRDGLQGPVGLPGPAGPVGPP
GEDGDKGEIGEPGQKGSKGDKGEQGPPGPTGPQGPIGQPGPSGADGEPGPRGQQGLFGQK
GDEGPRGFPGPPGPVGLQGLPGPPGEKGETGDVGQMGPPGPPGPRGPSGAPGADGPQGPP
GGIGNPGAVGEKGEPGEAGEPGLPGEGGPPGPKGERGEKGESGPSGAAGPPGPKGPPGDD
GPKGSPGPVGFPGDPGPPGEPGPAGQDGPPGDKGDDGEPGQTGSPGPTGEPGPSGPPGKR
GPPGPAGPEGRQGEKGAKGEAGLEGPPGKTGPIGPQGAPGKPGPDGLRGIPGPVGEQGLP
GAPGPDGPPGPMGPPGLPGLKGDSGPKGEKGHPGLIGLIGPPGEQGEKGDRGLPGPQGSS
GPKGEQGITGPSGPIGPPGPPGLPGPPGPKGAKGSSGPTGPKGEAGHPGPPGPPGPPGEV
IQPLPIQASRTRRNIDASQLMDEGEAENYMDYADGMEEIFGSLNSLKLEIEQMKRPLGTQ
QNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRDSFKVYCNFTAGGSTCVFPDKKSEGARI
TSWPKENPGSWFSEFKRGKLLSYVDAEGNPVGVVQMTFLRLLSASAHQNITYNCYQSVAW
QDAATGGYDKAMRFLGSNDEEMSYDNSPYIRALVDGCATRKGYQKTVLEIDTPKVEQVPI
VDIMFNDFGDASQKFGFEVGPACFLG
Download sequence
Identical sequences ENSSSCP00000006161 ENSSSCP00000006161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]