SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006241 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006241
Domain Number 1 Region: 669-824
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-36
Family MAM domain 0.00097
Further Details:      
 
Domain Number 2 Region: 987-1150
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.97e-31
Family MAM domain 0.0029
Further Details:      
 
Domain Number 3 Region: 62-219
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-29
Family MAM domain 0.0061
Further Details:      
 
Domain Number 4 Region: 827-984
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-27
Family MAM domain 0.0015
Further Details:      
 
Domain Number 5 Region: 269-423
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-17
Family MAM domain 0.013
Further Details:      
 
Domain Number 6 Region: 497-658
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000135
Family MAM domain 0.0083
Further Details:      
 
Domain Number 7 Region: 225-263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 8 Region: 460-497
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000903
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006241   Gene: ENSSSCG00000005832   Transcript: ENSSSCT00000006410
Sequence length 1233
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:313809243:313817969:-1 gene:ENSSSCG00000005832 transcript:ENSSSCT00000006410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPGHLLPALVLLLAGSLGWAWVPNRCRAPREAVCNFVCDCRGCPDEAQCGYHGAPPAP
GTPFSCHFEQDFCGWRDISTSGYSWLRERAGAAPGGPGPRSDHTLGTDLGWYAAVGTHRG
KEAATAALRSPVLHEAAPTCELRLWYHAASGDVAELRLELTHGAETLTLWQSSGPWRPGW
QELLVTTGRIRGDFRVTFSATRNATHRGAVALDDMAFGRCGLPTPQARCPLGHHHCQNKA
CVQPHQLCDGEDNCGDRSDEDTPTCSHHLATDFEMGLGLWNHSEGWARNHSTGRPQHPAW
PRGDHSRNSAQGSFLVSTAEPSDPAILSSPEFQASAPHNCSLVFYHYLHGSEAGCLQVFL
QARSSGAPQTPVLLRGRRGELGAAWVRDRVDIQSGRPFRILLAAQTGPGGVVGLDDLILS
DHCKPALAEAEPCPPDPSSAPTEGSGPPPGPWPQPFSLQPRNFCEPGHLFCEDLCVPPEQ
LCDFQQQCLGGEDEQECGTTDFEDPSAGGWEDASVGRLQWMRVSAQASRIPGADAAGNVA
GHFLSLQRAWGQLTEEARVLTPLLGPSGPRCELHLAYYFQSQPQGFLELVVVEGSRRELV
WQAPVHSPVGWKMDTILLGARHRPFRPPPAKLEFVGLVDLDGPGQQGAGVDHVTLKDCSP
TVATEKDAEVSCNFERDTCSWHTDHLTDAHWRRVESQGPRFDHTTGRGYFMLLDPTEPPA
QGPSAHLLTQPQAPTAPQECLSFWYHLHGPQIGTLRLAMRREGEADTHLWLRSGTHGNRW
HEAWATLHHPQDTSAKYQLLFEGLRDGYHGTMALDDVAVRPGPCSAPKRCSFEDSACGFS
TGGQGLWTRQTNATGHAAWGPHADHTTETAQGHYMVVDMSPQALPRGHVASLTSEAHRPL
AQPACLTFWYHLSLRNPGTLRVHVEEAKRRQVLSISTHGGFAWRLGSVDVQAERAWRVVF
EAVAAGVERAYIALDDLLLQDGPCPRPASCDFEAGLCGWHHLPWPGLGGYSWDWSSGATP
SRYRQPPVDHTLGTEKGHFALFETGVLGPGGRAAWLRSQPLPATEVSCLRFWYHMGFPEH
FYKGELRVLLSSAQGQLAVWGTGGHLRHQWLEGRVQVASAEEFQIVFEATLGGQPALGPI
ALDDVEYLAGQHCQQPAPSQGDRAVATSVPAMVGSALLLLAVLVLLGLVGRRWLRKRAGC
PSGGESEAPAPGFDNILFNADGITLPASVTTEQ
Download sequence
Identical sequences ENSSSCP00000006241 ENSSSCP00000006241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]