SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006313 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006313
Domain Number 1 Region: 132-226
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 1.44e-35
Family VPS28 C-terminal domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 25-119
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 5.23e-34
Family VPS28 N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006313   Gene: ENSSSCG00000005904   Transcript: ENSSSCT00000006484
Sequence length 228
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:453523:458897:1 gene:ENSSSCG00000005904 transcript:ENSSSCT00000006484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGMGASVYSVTAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALE
KAYIKDCVTPNEYTAACSRLLVQYKAAFRQVQGSEVSSIDEFCRKFRLDCPLAMERIKED
RPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPD
FEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA
Download sequence
Identical sequences ENSSSCP00000028977 ENSSSCP00000006313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]