SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006358 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006358
Domain Number 1 Region: 2153-2645
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.27e-45
Family Acetylcholinesterase-like 0.0000716
Further Details:      
 
Domain Number 2 Region: 91-165
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.76e-19
Family Thyroglobulin type-1 domain 0.0021
Further Details:      
 
Domain Number 3 Region: 985-1080
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.54e-19
Family Thyroglobulin type-1 domain 0.0011
Further Details:      
 
Domain Number 4 Region: 23-92
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.27e-18
Family Thyroglobulin type-1 domain 0.0019
Further Details:      
 
Domain Number 5 Region: 724-783,898-928
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.32e-18
Family Thyroglobulin type-1 domain 0.0058
Further Details:      
 
Domain Number 6 Region: 295-360
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.88e-17
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 7 Region: 614-664
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000000000000011
Family Thyroglobulin type-1 domain 0.0012
Further Details:      
 
Domain Number 8 Region: 659-731
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000000000144
Family Thyroglobulin type-1 domain 0.0016
Further Details:      
 
Domain Number 9 Region: 1144-1215
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000000000000249
Family Thyroglobulin type-1 domain 0.0016
Further Details:      
 
Domain Number 10 Region: 162-195,230-249
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000000497
Family Thyroglobulin type-1 domain 0.0066
Further Details:      
 
Domain Number 11 Region: 1075-1139
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000000811
Family Thyroglobulin type-1 domain 0.005
Further Details:      
 
Domain Number 12 Region: 1445-1491
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000000432
Family Thyroglobulin type-1 domain 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000006358
Domain Number - Region: 1385-1455
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000251
Family Growth factor receptor domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006358   Gene: ENSSSCG00000005948   Transcript: ENSSSCT00000006531
Sequence length 2688
Comment pep:known chromosome:Sscrofa10.2:4:8078927:8424690:-1 gene:ENSSSCG00000005948 transcript:ENSSSCT00000006531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALALWVFALLGSACLVSANIFEYQVDAQPLRPCELQRERAFLKRADYVPQCAEDGSFQT
VQCKKDGGSCWCVDADGREVPGSRQPGRPVACLSFCQLQKQQILLSSYINSTATSYLPQC
QDSGAYAPVQCDVRREQCWCVDAEGMEVYGTRRLGRPARCPGSCEIRNRRLLHGVGDKSP
PQCSADGTFLPVQCKFVNTTDMMFFDLVHSYNRFPDAFVTFSSFRSRFPEVSGYCHCADS
QGRELAGTGLELLLDEIYDTVFAGLDLASSFTETTLYRILQRRFLAVQLVTSGRFRCPTK
CEVERFAATSFGHPYVPSCGRDGEYQAGQCQQEGLCWCVDAQGQEIPGTRRPSEPLSCAE
GQSCPSERRRALSRLHLGPSGYSGQRGSFLAAERGPVSQTVPSFAASCPLPLKELFVESG
ILQPVVQGQKKEVTAATESLLKEGLRGIFPSRELARLALQFTANPKRLQQNLFGGRFLAN
VGQFNLSGALGTRGTFNFSHFFQQLGLPGFQKRQALADPAKSLSVGLDSNPATEAPEALK
MGVAMNKTVVGSFGFEVNLQENRNALTFLSSLLELPEFLLFLQHAISVPEDIARDLGDVM
EMALSSQGCEQTPGSLFVPSCTAEGSYEDVQCFAGECWCVDARGRELAGSRARGGRPRCP
TACEKQRERMQSLLGRQPAGSSVFVPSCTREGHFLPVQCFSSDCYCVDADGQPIPGTRTA
PGEPKQCPTPCQLQAEQAFLGTVRGLISNPSEPPVLSSIYIPQCSASGQWRRVQCDGPPE
QAFEWYERWGAQSRSGQELTPAELLMKIMSYREAASGSFRLFIQNLYEAGQQGIFPGLAR
YSSLQDVPLAVLEGNLTQATGNILLEPYLFWQILNGQLPRYPGPYSDFSAPLAHLDLRSC
WCVDEAGRKLEGTQTEPSKVPACPGSCEEVKLRVLQFIKEAEEIVMVSNSSQFPLGESFL
AAKGIRLTDEELALPPLSPSRETFLEKFLSGSDYAIRLAAQSTFSFYQRRRVALSDAPRT
SGPLQPYPYVPQCDALGSWEPVQCHAATGHCWCVDGEGAYLPASLAARSPQVLQCPTPCE
TSRVRGLLSAWKQAGSQVRPSPKDLFIPACTETGEFARLQASEASTWCVDPASGEAMPPG
TNSSAPCPGLCEVLQRGVPSRRASPGTTPACRAEDGGFAPVQCDPAQGSCWCVLGSGEEV
PGTRVAGSQPACERPQLWQTIQTRGQFQLQLPPGKVCSADYAGLLPTFQVVILDELTARG
FCRIQVTTARTPVSIPVCDDSTVRVGCLSLDRLGVNVTWTLRLEDAPPASLPDLRDIEEA
LAGKDLVGRFADLIQSGTFQLHLDSRTFPADPSIHFLQGNSLGTSPRTRFGCVEGSRQVP
ATSNTSQDPLGCVRCPEGSYFQEEQCIPCPAGFYQEQTGSLACAPCPAGTTTTSVGAFSQ
THCVTACQRDEAGLQCDQDGQYRASQRDRASGKAFCVDSEGRRLPWSETQAPLVDAQCLM
MRKFEKLPESKVIFTADVAVLGSIVPDSESSLMQCLADCARDEACSFLTVSLEGSEGSCD
FYAWTSDNIACTSSGQEEDALGTSKATSLGSLTCQVKVRPGDGVAPAVYLKKGQEFATIG
QKRFEQTGFQNALSGLYSPVVFSASGASLTEAHLFCLLACDRDSCCDGFILTQVQGGPII
CGLLSSPDVLLCHVRDWRDPSEAQADATCPGVTYDQDSRQGTLRLGGQEFKSLTPREGAR
DTFTSFQQVYLWKDSDMGSRSESMGCRRDMQPRPESPEETDLTAELFSPVDLNQVIVSEN
RSLPSQQHRLFKHLFSLQQAHLWCLSRCVQEPSFCQLAEITDSSPLYLTCTLYPEAQVCD
DVMEASPRGCRRILPRRPNALFQRRVVLQDRVKNFYTRLPFQKLTGLSIRHKVPMADKAI
SSGFFECERLCDVDPCCTGFAFLNVSQLKGGEVTCLTLNSLGLQTCSEENGGSWRLLACG
SPDTEVRTYPFGWYQKPGLPSDAPNLCPELHFPKVGSASSLESPAPTPPGSVTLGPSGRC
KDVGRTDTAAAGELTSSTESKNLEKHRTQTSLPQTYKHSPGGQRCQGYGTTQSCAISLQS
QNKWLLLTERASHMLRKPDDSLPGRGRSAPTGPTTTQGCFFGHAHGILLGAGWKKTFNFI
GVPFAVEPCAEFRLRVPKPLNPTATSDVGAPRAPCFSPGKNPATPGFGEDGSRRILFLPK
PITPESSVRVFFKNSGEKRLCLPLDLSTMSCDGNLIVVSCKRRSGTAGFLESGPSNVRGG
WKLLDRVVGVTWLQFHLGFLTLDPRQVGMEADSTAASVADMHTLESRASDARHFRRSLLG
GGSVLSPAAVIRPDRAQQQAAALAKEVGCPRPSQKWYPASAACQPPDAQSKLLAVSGPFH
YWGPVVDGQLLREAPARALQRPPRAKLDLLIGSSQDDGLIDRAKAVKRFEESQGRTSSKT
AFYQALQNSLGGEAGDPGVQAAATWYYSLEHDTDDYASFSRALEAATRDYFIICPVIDMA
SHWARTARGNVFMYHAPESYSHGSLELLADVRYAFGLPFYPAYEGQFTQEEKSLSLKIMQ
YFSNFVRSGNPNYPHEFSRKAPEFAAPWPDFVPGDGAESYKELSVLLPNRQGLKKADCSF
WSKYILSLKASADEAEDGPLAESEEEDRPGLTEDLLGLPELASKSYSK
Download sequence
Identical sequences ENSSSCP00000006358 ENSSSCP00000006358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]