SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006405 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006405
Domain Number 1 Region: 1004-1205
Classification Level Classification E-value
Superfamily vWA-like 1.91e-58
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 2 Region: 136-331
Classification Level Classification E-value
Superfamily vWA-like 8.26e-55
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 1224-1427
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.17e-34
Family Laminin G-like module 0.033
Further Details:      
 
Domain Number 4 Region: 441-608
Classification Level Classification E-value
Superfamily Fibronectin type III 9.53e-22
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 5 Region: 733-903
Classification Level Classification E-value
Superfamily Fibronectin type III 9.79e-19
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 6 Region: 347-434
Classification Level Classification E-value
Superfamily Fibronectin type III 1.48e-17
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 7 Region: 24-108
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000173
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 8 Region: 624-706
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000386
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 9 Region: 916-999
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000265
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006405   Gene: ENSSSCG00000005997   Transcript: ENSSSCT00000006580
Sequence length 1790
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:19716443:19949617:-1 gene:ENSSSCG00000005997 transcript:ENSSSCT00000006580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYWLFPAFLAVTYFCTIVQGQVAPPTRLRYNVLSHDSIQISWKAPRGKFGGYKLLVTPA
AGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYHKDKESKPAQGQFRIKDIEKRKEPK
PRVKVVDRDGNKPSTPEEEVKFFCQTPAIADIVILVDGSWSIGRFNFRLVRSFLENLVTA
FNVGSEKTRIAGLAQYSGDPRIEWHLNAFSTKDEVIEAVRNLPYKGGNTLTGLALNYIFE
NSFKPEAGARTGVSKIGILITDGKSQDDVIPPSRNLRESGVELFAIGVKNADENELREIA
SEPDNTHVYNVAEFDLMHTVVESLTRTVCSRVEEQDREIKASALAAIGPPTELLTSEVTA
RSFMVNWTHAPGKVEKYRVVYYPTRGGKPEEVVVDGSISSTVLKNLMSLTEYQIAVFAIY
AHTASEGLRGTETTLALPIASDLELYDVTENSLRARWNPVAGASGYLILYAPLTEGLAGD
EKEMKIGETHTDIELRGLLPNTEYTVTVYAMFGEEASDPVTGQETTLPLSPPRNLRISNV
GSNSARLAWDPTSRRISGYRIVYNNADGTEINEVEVDPITTFPLKGLTPITEYTVAIFSI
YDEGQSEPLTGIFSTEEVPAQQYLEIDEVMTDSFRVTWHPLSADEGQHKLMWIPVYGGKT
QEVVLKEDQDSYVIEGLEPGTEYEVSLLAVLDDGSESEVVTAVGTTLDSFWTEPATTVLP
TRPVTSVFRTGIRNLVVDDETTSSLRVKWDISDSSVQQFRVTYLTAQGDPAEEVVGTVMV
SGNQNDLLLKNLLSNTEYKVTVTPIYDDGEGVSVSAPGKTLPPSGPQNLRVSEEWYNRLR
ITWDPPSSPVKGYRIVYKPVSVAGPTLETFVGANINTILITNLLSGMDYNVKIFASQASG
FSDALTGVVKTLFLGVTDLQADQIQMTSLCARWQVQRHATAYRIVIESLQDTQKQESTLG
GGTTRHCFYGLQPDSQYKISVYTKLQEMEGPSVSIMEKTKSLPTPPPTFPPTIPPAKEVC
KAAKADLVFMVDGSWSIGDENFNKITNFLYSTVGALDKIGADGTQVAMVQFTDDPRTEFK
LNTYKTKETLLDAIKHISYKGGNTKTGKAIKHVRDNLFTAESGIRRGIPKVIVVITDGRS
QDDVNKISKEMQLDGYSIFAVGVADADYSELVSIGSKPSARHVFFVDDFDAFKKIEDELI
TFVCETASATCPLVHKDGIDLAGFKMMELFGLVEKDFSSVEGVSMEPGTFNVYPCYHLHK
DALVSQPTKYLHPEGLPSDYTISFLFRVLPDTPEEPFALWEILNKNSDPLVGVILDNGGK
TLTYFNYDYSGDFQTVTFEGPEIRKIFYGSFHKLHIIVSKTMAKVVIDCKEVGEKAINAS
SNITSDGVEVLGRMVRSRGPNGNSAPFQLQMFDIVCSTSWANKDKCCELPGLRDEETCPE
LPHSCSCSEINKGALGPAGPPGGPGLRGPKGQRGEPGPKGPDGPRGETGPPGHQGPPGPQ
GPSGLSIQGMPGMPGEKGEKGETGLPGPQGIPGSVGSPGRDGSPGQRGFPGKDGSSGPPG
PPGPIGIPGAPGVPGITGSMGPQGALGPPGAPGAKGERGERGDLQSQAMVRAVARQVCEQ
LIQSHMARYTAILNQIPSHSSSIRTIQGPPGEPGRPGSPGAPGEQGPPGSPGFPGNAGVP
GTPGERGLTGVKGEKGNPGIGTQGPRGPPGPAGPSGESRPGSPGPPGSPGPRGPPGHLGV
PGPQGPSGQPGYCDPSSCSAYGVGATHPDQPEFTPVQDELEAMELWGSGI
Download sequence
Identical sequences ENSSSCP00000006405 ENSSSCP00000006405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]