SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006520 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006520
Domain Number 1 Region: 27-176
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000267
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006520   Gene: ENSSSCG00000006108   Transcript: ENSSSCT00000006700
Sequence length 793
Comment pep:known chromosome:Sscrofa10.2:4:46289107:46341919:-1 gene:ENSSSCG00000006108 transcript:ENSSSCT00000006700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPLASHHGDGQLWSWGGNGRQQPETCGHNQYFDISALSCVPCGANQMQDAGGTSCVCL
PGFQMISNNGGPDIICKKCPESMKGVTEDGWNCISCPDGLTAEGKCHCPTGHILVERDVN
GTLLSQATCKLCDDSENSFTVANALGTRCVRCEPTFINTSRSCACSEPNILTGELCFSST
GNFPPHMISTARYGELGKSFTSEWFAKYLQSSAAACWVYANLTSCQALGNMCVMNMNSYH
FATFDACQLFQFIFENTAGLHTVHSISFWRQNLPWLFFGDQLGLAPQVLSTIPLPTNFSF
KGENQNTKLKFVAASYDVRGNFLKWQTLEGGVLQLCPDTETRLNAAYSFGTTYQQNCEIP
ISKILTDFPTPTFYDVYIEYTDENQHQYIWAVPVLNLNLQHNKIFVNQDSNSGKWLLTRR
IFLVDALSGRENDLGSQPRLIRVATQISLSIHLVPNTKNGNIYPPLITIAYSDIDVSDPN
SQSVKVSFSVEYEMDQKEAHIQTDIALGVLGGLAVLSSLLKTAGWKRRIGSPMIDLQTVM
KFLFYYAGDLANVFFTITLGTGLYWLIFFKAQMSVSVLLPTPAQEKRFVTYVGCAFALKA
LQFLHKLFSQITIDIFFIDWERPKGKILKAVEGEGGVRSATVPVSIWRTYFVANEWNEIQ
TVRKINPLFQVLTVLFLLEVVGFKNLALMDSSSSLSRSPPSYIAPYSRILRYAVSTVLWL
VIGIIQIMFFAVFYERFIEDKIRQFVDLCCMSNISVFLLSHKCFGYYIHGRSVHGHADTN
MEEMNMNLKREAV
Download sequence
Identical sequences ENSSSCP00000006520 ENSSSCP00000006520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]