SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006530 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006530
Domain Number 1 Region: 129-285
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.22e-37
Family Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006530   Gene: ENSSSCG00000006120   Transcript: ENSSSCT00000006712
Sequence length 292
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:49397921:49414328:-1 gene:ENSSSCG00000006120 transcript:ENSSSCT00000006712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVLTEELDEEEQLVRRHRKEKKELQAKIQSMKNVVPKNDKKRRKQLTEDVAKLEAEME
QKHRKELEQLKLTSKESKIDSVAVNISNLVLENQPLRISKAQKRREKKAALEKEREERIA
EAEIENLTGARHVESEKLAQILGARQLEIKQIPSDGHCMYRAIEDQLKEQECTLTVAALR
SQTADYMQSHVEDFLPFLTNPNTGEMYTPEEFGKYCDDIVNTAAWGGQLELRALSHILRS
PIEIIQADSPPIVVGEEYSKKPLILVYMRHAYGLGEHYNSVTQLNTATENCS
Download sequence
Identical sequences F1RXF7
ENSSSCP00000006530 ENSSSCP00000006530 9823.ENSSSCP00000006530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]