SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006559 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000006559
Domain Number - Region: 117-165
Classification Level Classification E-value
Superfamily Tropomyosin 0.0333
Family Tropomyosin 0.0041
Further Details:      
 
Domain Number - Region: 169-202
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0968
Family TSP type-3 repeat 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006559   Gene: ENSSSCG00000006149   Transcript: ENSSSCT00000006742
Sequence length 211
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:56868078:57058815:-1 gene:ENSSSCG00000006149 transcript:ENSSSCT00000006742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLSVGGYVFDYDYYRDDFYNRLFDY
HGRVPPPPRAVIPLKRPRVAGTTTRRGKGVFSMKGGSRSTVSGSSSSGSKLKSDELQTIK
KELTQIKTKIDSLLGRLEKIEKQQKAEAEAQKKQLEESIELIQDECVSENADHSTEEPAE
GGPDADGEEMTDGIEEDFDEDGGHELFLQIK
Download sequence
Identical sequences ENSSSCP00000006559 ENSSSCP00000006559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]