SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006594 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006594
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006594   Gene: ENSSSCG00000006183   Transcript: ENSSSCT00000006777
Sequence length 193
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:68314290:68336217:1 gene:ENSSSCG00000006183 transcript:ENSSSCT00000006777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARPCIVGEWSPWSGCADQCKPTARVRRRAVRQEPQNGGAPCPALEERAGCLEYATAQGQD
CGHAFVPAFITTSAFNKERTRRAASPQWSADTEDAGYCMEFKTESLTHHCALENRPLTRW
MQYLREGYTVCVGCQPPAMNAVSLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVE
QCSCPAVHSFIFI
Download sequence
Identical sequences 9823.ENSSSCP00000006594 ENSSSCP00000006594 ENSSSCP00000006594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]