SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006645 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006645
Domain Number 1 Region: 29-289
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.06e-66
Family Carbonic anhydrase 0.00000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006645   Gene: ENSSSCG00000006233   Transcript: ENSSSCT00000006830
Sequence length 291
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:79510026:79581189:1 gene:ENSSSCG00000006233 transcript:ENSSSCT00000006830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLSFIEDSVAFPEKEEDEEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREA
RYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHW
GRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGL
KAVTEILQDIQYKGKSKTIPCFNPNTLLPVMLFSSYSKYLGMLTFSCCSRYHMWLLSNHP
NVLSEFQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Download sequence
Identical sequences ENSSSCP00000006645 9823.ENSSSCP00000006645 ENSSSCP00000006645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]