SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006743 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006743
Domain Number 1 Region: 108-594
Classification Level Classification E-value
Superfamily ALDH-like 1.18e-166
Family ALDH-like 0.00000000000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006743   Gene: ENSSSCG00000006324   Transcript: ENSSSCT00000006932
Sequence length 598
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:92685722:92713628:1 gene:ENSSSCG00000006324 transcript:ENSSSCT00000006932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVPKSLPNSALEGRALARRPGNSSPSPATPLSPLRELCPRAACPSHGPAPSPFRLSVPP
PKPCPSPRPLNWCPRLPRVFLRAGLAVLSPLLRTLRPAPVAAMSTGTFIVSQPLNYRGGA
RVDPVDASGTEKAFEPATGRVIATFTCSGEKEVNLAVQDAKAAFKIWSQKSGMERCRILL
EAARIIRPKERKEEIATMETINNGKSIFEARLDVDISWQCLEYYAGLAGSMAGEHIQLPG
GSFGYTRREPLGVCVGIGAWNYPFQIACWKSAPALACGNAMIFKPSPFTPLSVLLLAEIY
TEAGVPPGLFNVVQGGATTGQLLCQHRDVAKISFTGSVPTGSKIMEMSAKGIKPVTLELG
GKSPLIIFSDCDMGNAVKGALMANFLTQGEVCCNGTRVFVQKEILDKFTEEVVKQTQRIK
IGDPLLEDTRMGPLINRPHLERILGFVKVAKEQGAKVLCGGDLYVPEDPKLKEGYYMRPC
VLTNCRDDMTCVKEEIFGPVMSILSFDTEAEVVERANDTTFGLAAGVFTRDIQRAHRVVA
ELQAGMCFINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESVF
Download sequence
Identical sequences ENSSSCP00000006743 ENSSSCP00000006743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]