SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006781 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006781
Domain Number 1 Region: 210-556
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.94e-99
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006781   Gene: ENSSSCG00000006362   Transcript: ENSSSCT00000006971
Sequence length 565
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:97145766:97150909:-1 gene:ENSSSCG00000006362 transcript:ENSSSCT00000006971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQASEHRLGRTREPPLNVQPRVGSKLPFAPRARSKERRNPAPGPNPMLRPLPPRPGPPE
ERLKKLELGRGRTSGPRPRGPLRADHGVPLPGSPPPTVALPLPSRTNLARSKSVSSGDLR
PMGIALGGHRGTGELGAALSRLALRPEPPTLRRSTSLRRLGGFPGPPTLLSIRTEPPTSH
GSFHVISARPSEPFYSDDKMAHHTLLLGSGHVGLRNLGNTCFLNAVLQCLSSTRPLRDFC
LRRDFRQEVPGGGRAQELTEAFADVIGALWHPDSCEAVNPTRFRAVFQKYVPSFSGYSQQ
DAQEFLKLLMERLHLEINRRGRRAPPILASSPAPSPPRRGGALLEEPELSDDDRANLMWK
RYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCF
SLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRFSASRGSIKKSSVGV
DFPLQRLSLGDFASDKAGSPIYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPV
SENQVASSEGYVLFYQLMQEPPRCL
Download sequence
Identical sequences F1S196
XP_001927817.1.46622 ENSSSCP00000006781 9823.ENSSSCP00000006781 ENSSSCP00000006781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]