SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006888 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000006888
Domain Number - Region: 232-343
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0033
Family Growth factor receptor domain 0.0029
Further Details:      
 
Domain Number - Region: 586-700
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00565
Family Growth factor receptor domain 0.0029
Further Details:      
 
Domain Number - Region: 363-410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.1
Family Laminin-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006888   Gene: ENSSSCG00000006463   Transcript: ENSSSCT00000007080
Sequence length 1038
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:101749212:101777229:-1 gene:ENSSSCG00000006463 transcript:ENSSSCT00000007080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPPLRSLLLLALALGLAGTLNPKDPNTCSFWESFTTTTKESHLRPFSLLPSEPCDRPWE
SPHTCPRPTVVYRTVYRQVVKTEHRKRLQCCQGFYESRGACVPLCSQECVHGRCVAPNQC
QCVQDWRGDDCSSACAPGVWGPQCDKPCNCGNSSSCDPKSGACSCPPGLQPPHCLQPCSP
GRYGPACQYSCQCHRAPCDPQTGACLCPPERTGPSCEESCSLSTFGFSCPSIPPCHNGGV
FQASQGSCSCPPGWMGTICSLPCPEGFHGPNCSQECRCHNGGLCDRFTGQCRCAPGYTGD
RCREECPVGYFGQDCAEMCDCAPGARCFPANGACLCEHGFTGDRCAERLCPDGLYGLSCQ
VPCTCDPEHSFSCHPMSGECSCLPGWAGLHCNESCPQDTHGPGCQEHCLCLHGGVCQPDS
GLCRCAPGYTGPHCASLCPPDSYGVNCSSRCSCENAIACSPVDGACICKEGWQRGNCSIP
CPPGTWGFNCNASCQCAHGAACSPQTGACTCTPGWHGAHCQLPCPKGQFGEGCASHCDCD
HSDGCDPVHGRCHCQAGWTGTRCHLPCPEGFWGTNCSNTCTCKNGGTCIPENGNCVCAPG
FRGPSCQRPCQPGRYGKRCVPCKCANHSSCHPSNGTCYCLAGWTGPDCSQPCPLGHWGAN
CAQLCQCRHGGTCHPQDGSCFCPPGWIGHLCLEGCPPGMFGANCSQPCQCGSGERCHPET
GACVCPPGHSGAPCRIGSQEPFTMMPTAPVAYSSVGAVIGIAVLGSLVVALVVLFIGYRH
WQKGKEHQHLAVAYSSGRLDGSEYVMPDVPPSYSHYYSNPSYHTLCSPNPPPPNKVPGSQ
LFVSLQTPERPGGTPGHENHATLPADWKHRREPPPGPLDRGSSRLDRSYSCSYSNSNGPG
PFYSKGPISEEGLGASMASLSSENPYATIRDLPSLLGSPRESSYVEMKGPPSGSPPRQPP
QLRDSQRRRHPQPQRDSGTYEQPSPLTHDRDSMGSQPPLPPGLPPGHYDSPKNSHIPGHY
DLPPVRHPPSPPLRRQDR
Download sequence
Identical sequences F1RHK7
ENSSSCP00000006888 ENSSSCP00000006888 9823.ENSSSCP00000006888 XP_001929552.1.46622 XP_020945312.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]