SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006952 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006952
Domain Number 1 Region: 724-939
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-104
Family Thrombospondin C-terminal domain 0.0000000858
Further Details:      
 
Domain Number 2 Region: 597-722
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.88e-34
Family TSP type-3 repeat 0.00000384
Further Details:      
 
Domain Number 3 Region: 515-599
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.01e-19
Family TSP type-3 repeat 0.0000667
Further Details:      
 
Domain Number 4 Region: 225-270
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000000109
Family Assembly domain of cartilage oligomeric matrix protein 0.002
Further Details:      
 
Domain Number 5 Region: 447-540
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000929
Family TSP type-3 repeat 0.00017
Further Details:      
 
Domain Number 6 Region: 315-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000908
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 52-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000522
Family Laminin G-like module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000006952
Domain Number - Region: 423-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00101
Family EGF-like domain of nidogen-1 0.063
Further Details:      
 
Domain Number - Region: 363-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006952   Gene: ENSSSCG00000006524   Transcript: ENSSSCT00000007145
Sequence length 956
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:103395530:103406728:1 gene:ENSSSCG00000006524 transcript:ENSSSCT00000007145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQELRGALALLFLCTFASASQDLQVIDLLTLGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTALLRLRGPSRPSPALQLYVDCKLGDQHAGLPALAPIPPAEVNGLEIRTGQKAYLRM
QGFVESMKMILGGSMARVGALSECPFQGDESIHSAVASALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPTPCFRGVDCMEVYEYPGYCC
GPCPPGFQGNGTHCTDINECAHADPCFPGSSCINTMPGFHCEACPRGYKGTRVSGVGIDY
ARASKQVCNDIDECNDGDNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSHGCFPARTCHS
PAHSPCHVHAHCLFERNGAVSCLCNVGWAGNGNVCGPDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGVPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGAIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
Download sequence
Identical sequences ENSSSCP00000006952 ENSSSCP00000006952 9823.ENSSSCP00000006952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]