SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007075 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000007075
Domain Number - Region: 48-103
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 0.0314
Family Molybdopterin synthase subunit MoaE 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007075   Gene: ENSSSCG00000006634   Transcript: ENSSSCT00000007270
Sequence length 184
Comment pep:novel chromosome:Sscrofa10.2:4:107346210:107349280:-1 gene:ENSSSCG00000006634 transcript:ENSSSCT00000007270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFSSKSLALQAEKKLLSKMAGRSVVHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVI
KDLIKVAIKVAVLHRSGCFSPSELALATRFRQKLRQGAMTVLSFSEVDFTFEAAVLASLL
TECRDMLLELVAQHLTPKSHGRIRHVFDHFSDLGLLTALYGPDFTSRLGKICDGLRKLLD
EGKL
Download sequence
Identical sequences F1SSY0
NP_001191299.1.46622 XP_005663517.1.46622 ENSSSCP00000007075 ENSSSCP00000007075 9823.ENSSSCP00000007075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]