SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007087 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007087
Domain Number 1 Region: 353-455
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.68e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 164-218,245-260,288-306
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-16
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 82-165
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 557-726
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0000000706
Family Tetraviridae-like VP 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007087   Gene: ENSSSCG00000006646   Transcript: ENSSSCT00000007282
Sequence length 781
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:107586820:107636206:1 gene:ENSSSCG00000006646 transcript:ENSSSCT00000007282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTADVPSLGPAITSGNPGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSN
DKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKL
TILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYV
SDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQ
QSSMRMCMGSRRSFICRMRCGSSSVDPVSMNRLSFVRNRCRNGLGSVKDGEPHFVVVHCT
GYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNI
EGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRF
RSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTAN
LSLEMGSGQLAPRQQQQQTELDVVPGRDGLASYNHSQVSVQPVTTTGPEHSKPLEKSEGL
FAQDRDPRFSEIYSNINTDQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPP
VTIVQPSASAGQMLAQISRHSNPTQGAAPAWTPSTRPGFSAQQVATQATAKTRSSQFGVG
NFQTPSSFSPMSLPGASTASPGAAAYPSLTNRGSSFAPETGQNAGQFQTRTAEGVGVWPQ
WQGQQPHHRSSSNEQHVQQSSAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPSFS
E
Download sequence
Identical sequences XP_020944337.1.46622 ENSSSCP00000007087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]