SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007088 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007088
Domain Number 1 Region: 19-328
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.6e-120
Family Papain-like 0.0000000000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007088   Gene: ENSSSCG00000006647   Transcript: ENSSSCT00000007283
Sequence length 330
Comment pep:known chromosome:Sscrofa10.2:4:107641167:107653106:1 gene:ENSSSCG00000006647 transcript:ENSSSCT00000007283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGLKVVLLLPVMSSALYPEEILDTQWELWKKTYRKQYNSKVDEISRRLIWEKNLKHISI
HNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPPSHSRSNDTLYIPDWEGRTPDSI
DYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGG
GYMTNAFQYVQKNRGIDSEDAYPYVGQDENCMYNPTGKAAKCRGYREIPEGNEKALKRAV
ARVGPVSVAIDASLTSFQFYSKGVYYDENCNSDNLNHAVLAVGYGIQKGKKHWIIKNSWG
ENWGNKGYILMARNKNNACGIANLASFPKM
Download sequence
Identical sequences Q9GLE3
ENSSSCP00000007088 ENSSSCP00000007088 9823.ENSSSCP00000007088 NP_999467.1.46622 XP_005663523.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]