SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007089 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007089
Domain Number 1 Region: 31-340
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.78e-115
Family Papain-like 0.00000000813
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007089   Gene: ENSSSCG00000006648   Transcript: ENSSSCT00000007284
Sequence length 342
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:107666299:107691564:1 gene:ENSSSCG00000006648 transcript:ENSSSCT00000007284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCIGAPAGSIIMKCLVWVLLLCSSAMAQLHRDPTLDRHWDLWKKTYGKQYKEKNEEVARR
LIWEKNLKTVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVISLMSCVRVPSQWPRNVTYKS
NPNQKLPDSMDWREKGCVTEVKYQGSCGSCWAFSAVGALEAQVKMKTGRLVSLSAQNLVD
CSTEKYRNKGCNGGFMTEAFQYIIDNNGIDSEASYPYKAVDGKCKYDSKNRAATCSRYTE
LPFADEYALKEAVANKGPVSVAIDAKHSSFFFYRSGVYYDPSCTQNVNHGVLVVGYGNLN
GKDYWLVKNSWGLNFGDGGYIRMARNSENHCGIANYPSYPEI
Download sequence
Identical sequences 9823.ENSSSCP00000007089 ENSSSCP00000007089 ENSSSCP00000007089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]