SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007092 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007092
Domain Number 1 Region: 44-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 772-830
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000405
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 961-1015
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000484
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 714-772
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000942
Family TSP-1 type 1 repeat 0.007
Further Details:      
 
Domain Number 5 Region: 902-960
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000432
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 6 Region: 834-898
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000157
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000007092
Domain Number - Region: 657-712
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000103
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007092   Gene: ENSSSCG00000006651   Transcript: ENSSSCT00000007287
Sequence length 1064
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:107824820:107833437:-1 gene:ENSSSCG00000006651 transcript:ENSSSCT00000007287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKQAIRPGLCLMLLLSLPQLCLDQEVLSGHSLQTPPEESQGPEGVWGPWDQWASCSQPC
GVGVQRRSRKCQLPAAHLHQGRPPRHPEGLLPRGQGPRPQTSRETLPLYRPPPRGRGGPF
RGPASQLGREEARETQGARRSRVRDPIKPGMFGYGRVPFALPLHRNRRHPRRPLRSELSQ
TSDLPSLMPRAVPSSANHTPQTELPPTAPSAPARSPPADSPSPEAAQTEVPSRTEPAPTG
PHPSTRASVTGPSSPPPPGEGRSFHASPQPRRPGSQGGASPQLAERHPHPFLSVPPGRGQ
QSPERWRPGGDRLRSLTESAPHHPHGWLPLLSTGPHSSSLWSLFAPSSPVPRCSGESEQL
RACSQAPCPPEQPDPRALQCAAFDSQEFMGQLYQWEPFTEVQGSQRCELNCRPRGFRFYV
RHTEKVQDGTLCQPGALDICVAGRCLSPGCDGILGSGRRPDGCGVCGGDDSTCRLVSGNL
TDPGGSLGYQKILVIPAGASRLHIAQLRPSSNYIALRGPGGQSIINGNWAVDPPGSYTAG
GTVFRYNRPPREEGAGESLSAEGPTTQPVDVYMIFQEESPGVFYQYVISSPPPDLENPTP
EPHLPQLQPEIFRVEPPPASASRPARTPGTLQRQVRIPQMPAPSHPRTHLGSPTGYWKRV
GHSECSASCGKGVWRPIFLCVSRESGEELDERSCAMGARPPASQEPCHGPPCPPYWETGE
WTSCSRSCGPGTQHRQLRCRQEFGGGGSSVPPERCGHLPRPNITQPCQLRLCGHWEVRSP
WSQCSVRCGRGQRSRQVRCVGNNGDEVSEQECASGPPRPPSREACDMGPCTTAWFHSDWS
SKCSAECGTGIQRRSVVCLGSGEAHGVGQEEAGAGASEQTCAPGSRPPDMRACSLGPCEV
TWCWYTGPWAECSSECGSGTQRRDIICVSKLGTEFNVTSPSNCSHLPRPPALQPCQGQNC
QDRWFSTPWSPCSRSCQGGVQTREVQCLTANQTLSTRCPPHLRPSRKRSCNSQPCSQRPD
DQCKDSSPHCPLVVQARLCVYPYYTSTCCRSCAHVLERSPPEPA
Download sequence
Identical sequences F1SS80
XP_005663557.1.46622 XP_020945555.1.46622 ENSSSCP00000007092 ENSSSCP00000007092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]