SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007138 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000007138
Domain Number - Region: 69-166
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0377
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007138   Gene: ENSSSCG00000006694   Transcript: ENSSSCT00000007333
Sequence length 251
Comment pep:novel chromosome:Sscrofa10.2:4:109493951:109522547:-1 gene:ENSSSCG00000006694 transcript:ENSSSCT00000007333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFLIDSSIMITSQILFFGFGWLFFMRQLFKDYEVRQYVVQVIFSVTFAFSCTMFELIIF
EILGVLNSSSRYFHWKMNLCVILLILVFMVPFYIGYFIVSNIRLLHKQRLLFSCLLWLTF
MYFFWKLGDPFPILSPKHGILSIEQLISRVGVIGVTLMALLSGFGAVNCPYTYMSYFLRN
VTDTDILALERRLLQTMDMIISKKKRMAMTRRTMFQKGEVHNKPSGFWGMIKSVTTSAPG
SESNTYLMGLF
Download sequence
Identical sequences ENSSSCP00000007138 ENSSSCP00000007138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]