SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007174 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007174
Domain Number 1 Region: 25-145,206-227,399-666
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.26e-68
Family Quinoprotein alcohol dehydrogenase-like 0.03
Further Details:      
 
Domain Number 2 Region: 144-235,282-304
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00000000889
Family Galactose oxidase, central domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007174   Gene: ENSSSCG00000006727   Transcript: ENSSSCT00000007369
Sequence length 943
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:112790956:112841012:-1 gene:ENSSSCG00000006727 transcript:ENSSSCT00000007369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLTKQYLRYVASAVFGLIGSQKGNIVFVTLRGEKGRYVAVPACEHVFIWDLRKGEKILI
LQGLKHEVTCLCPSPDGLHLAVGYEDGSIRIFSLLSGEGNVTFNGHKAAVTSLKYDQLGG
RLASGSKDTDIIVWDVINESGLYRLKGHKDAITQALFLREKNLLVSSGKDTMVKWWDLDT
QHCFKTVVGHRTEVWGLVLVSEEKRLITGASDSELRAWDIAYLEEIEDPEEPEPKKIKGS
SPRMQDTDETEDGTLEMDEAPEDRILTCRKAGSIMREGRDRVVNLAVDRTGRILACHGTD
SVLEVFRVLSIEEIQKKMDKKLKKARKKAKLNSGKEEEEDLEVSVEMTLQDEIQRVTNIK
TSAKIKSFDVIHSPQGELKAVFLLQNNLVELYSVYPSVPASQPVRTSRITIGGHRSDVRT
LSFSSDNIAVLSGAAESIKIWNRSTLQCIRTMTCEYALCSFFVPGDRQVVIGTKTGKLQL
YDLASGNLLETVDAHDGALWSLSLSPDQRGFVTGGADKSVKFWDFELVKDENSTQKRLSV
KQTRTLQLDEEVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLKFFLSLYGHKLPVICMDIS
YDGALIATGSADRNVKIWGLDFGDCHKSLFAHDDSVMYLKFVPKSHLFFTAGKDRKIKQW
DADKFEHVQTLEGHHQEIWCLAISPSGDYVVSSSHDKSLRLWERTREPLILEEEREMQRE
AEYEESVAKEDQPAVPGETQGDNYFTGKKTIETIKAAERLMEAIELYREETAKMREHKAI
CKAAGKEVPLPINPILMAYGNISPSAYVLEIFKGIKSSELEESLLVLPFSYVPDILKLFN
EFIQLGSDIELLCRCLFFLLRIHFGQITSNQMLVPVIEKLKETTISKVSQVRDVIGFNMA
GLDFLKRECEARSEVMFFADATSHLEEKKRKRKKREKLILTFT
Download sequence
Identical sequences ENSSSCP00000007174 ENSSSCP00000007174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]