SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007209 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000007209
Domain Number - Region: 27-101
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 0.0131
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0097
Further Details:      
 
Domain Number - Region: 219-331
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0471
Family DPP6 N-terminal domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007209   Gene: ENSSSCG00000006759   Transcript: ENSSSCT00000007404
Sequence length 407
Comment pep:known chromosome:Sscrofa10.2:4:116704502:116707235:-1 gene:ENSSSCG00000006759 transcript:ENSSSCT00000007404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRTPVLILVLLSWSGPIQGQQQHLVEYMERRLAALEERLAQCQDQSSRHAAELRDFKN
KMLPLLEVAEKEREALRTEADTIAGRVDRLEREVDYLETQNPASPCVEVDEKVTGGPGTK
GKGRRRNEKYDMVTDCGYTISQVRSMKILKRFGGPAGLWTKDPLGPTEKIFVLDGTQNDT
AFVFPRLRDFTLAMAARKASRIRVPFPWVGTGQLVYGGFLYYARRPPGGPGGGGDLENTL
QLIKFHLANRTVVDSSVFPAEGLIPPYGLTADTYIDLAADEEGLWAVYATREDDRHLCLA
KLDPQTLDTEQQWDTPCPRENAEAAFVICGTLYVVYNTRPASRARIQCSFDASGTLTPER
AALPYFPRRYGAHASLRYNPRERQLYAWDDGYQIVYKLEMRKKEEEV
Download sequence
Identical sequences H6UWK6
ENSSSCP00000007209 ENSSSCP00000007209 XP_005655478.1.46622 9823.ENSSSCP00000007209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]