SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007291 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007291
Domain Number 1 Region: 653-764,793-857
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0000000000621
Family Mannose 6-phosphate receptor domain 0.0089
Further Details:      
 
Domain Number 2 Region: 275-413
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000785
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 584-659
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000571
Family Growth factor receptor domain 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000007291
Domain Number - Region: 53-116
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0246
Family Growth factor receptor domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007291   Gene: ENSSSCG00000006836   Transcript: ENSSSCT00000007487
Sequence length 1013
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:121378122:121448363:-1 gene:ENSSSCG00000006836 transcript:ENSSSCT00000007487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPGHSLHPSARGRGRTERRTLRLLRLLLWVGTAFQVTQGAGLELHACKESEYHYEYTA
CDSTGSRWRVAVPHTPGLCTSLPDPVKGTECSFSCKAGEFLDMKDQSCKPCAEGRYSLGT
GIRFDEWDELPHGFASLSTNMEIEDSTIGSTGNCTSSKWVPLGDYISSNTDECTATLMYA
VNLKQSGTVNFEYYYPDSSIIFEFFVQNDQCQPNADDSRWMKTTEKGWEFHSVELNRGNN
VLYWRTTAFSVWSKVSKPVLVRNIAITGVAYTSECFPCKPGTYADKQGSSFCKLCPANTY
SNKGETSCHQCDPDKYSEKGSSTCRVRPACTDKDYFSTHTACDASGETQLMYKWAQPKIC
SEDLEGAVKLPASGVKTHCPPCNPGFFKTNSSTCEPCPYGSYSNGSDCSHCPAGTEPAVG
FEYKWWNTLPTNMETTVLSGINFEYKGMTGWEVAGDHIYTAVGASDNDFMILTLVVPGFR
RPQSVMADTENKEVARITFVFETDCSVNCELYFMVGVNSRTNSPVETWKGSKGKQSYTYI
IQENTTMSFTWAFQRTTSHETGRKYTNDVAKIYSINVTNVMDGVASYCRPCALEASDLGS
SCTSCPAGYYIDRDSGTCHSCPPNTILKAHQPYGAQACIRCGPGTKSNKIHSLCYNDCTF
SVNTTTRTFDYNFLALGNTVSLAGGPSFTSKGLKYFHHFTLSLCGNQGKKMSVCTDNVTD
LRIPDGESGFSKSISAYICQAVIIPSEVTGYKAGVSSQPVSLADRLIGVTTAMTLDGITS
PAELFHPESLGIPDVIFFYRSNDVTQSCSSGRSTTIRLRCSPLKPAPGSLLLPSTCSDGT
CDGCNFHFLWESVAACPLCSAADYHAIVSSCTAGIQKTTYVWREPKLCSGGISLPEQRVT
ICKTIDFWLKVGISAGTCTAILLTVLTCYFWKKNRKLEYKYSKLVMNATLKDCDLPAADS
CAIMEGEDVEDDLIFTSKKSLFGKIRSFTSKRTPDGFDSVPLKTSSGGPDMDL
Download sequence
Identical sequences 9823.ENSSSCP00000007291 ENSSSCP00000007291 ENSSSCP00000007291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]