SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007339 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007339
Domain Number 1 Region: 39-161
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.0000163
Family UDP-N-acetylglucosamine 2-epimerase 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007339   Gene: ENSSSCG00000006885   Transcript: ENSSSCT00000007539
Sequence length 216
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:134085867:134202787:1 gene:ENSSSCG00000006885 transcript:ENSSSCT00000007539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGALILAAAGAALAVLLAVRLWVVLRPRAAVPRRSLSLLVVAGSGGHTTEILRLLETLS
DAYSPRHYVIADTDEMSAHKINSFELNRADRNPSTTFPEYHIHRIPRSREVQQSWPSSAL
STLYSLWFSFPLTHRVKPDLVLCNGPGTCVPICISALLLGILGIKKVIIVYVESICRVEH
LSLSGKILFHLSDYFIVQWPALKKKYPKSVYLGRIV
Download sequence
Identical sequences F1S544
9823.ENSSSCP00000007339 ENSSSCP00000007339 ENSSSCP00000007339 XP_001924741.1.46622 XP_005655522.1.46622 XP_013843629.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]