SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007442 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007442
Domain Number 1 Region: 258-314
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000000000144
Family VPS37 C-terminal domain-like 0.007
Further Details:      
 
Domain Number 2 Region: 2-64
Classification Level Classification E-value
Superfamily UBC-like 0.000000168
Family UBC-related 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007442   Gene: ENSSSCG00000006984   Transcript: ENSSSCT00000007649
Sequence length 330
Comment pep:known chromosome:Sscrofa10.2:17:5408972:5431991:1 gene:ENSSSCG00000006984 transcript:ENSSSCT00000007649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPPQFPQEKPVISVYPPVRHHLVDKQGVYVTSPLINNFTMHSDLGKIIQSLLDEFWKNP
PVLAPASTAFPYLYGNPSGMPPYASQGFPFLPPYPPQEANRTISSLSVADTVSSSTTSYT
TAKPAAPSFGVLSNLPLPVPTTDTSAPISQNGSGYKMPDVPDAFPELSELSVSQLTDMNE
QEEVLLEQFLTLPQLKQIITDKDDLVKNIEELARKNLLLEPSLEAKRQSVLDKYELLTQM
KSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTDIDDFLSSFM
EKRTIYHCRRAKEEKLQQVIAMHSQFHAPL
Download sequence
Identical sequences ENSSSCP00000007442 ENSSSCP00000007442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]