SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007459 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007459
Domain Number 1 Region: 3811-4011
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-38
Family Laminin G-like module 0.0046
Further Details:      
 
Domain Number 2 Region: 3328-3439
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-31
Family Cadherin 0.00096
Further Details:      
 
Domain Number 3 Region: 3222-3326
Classification Level Classification E-value
Superfamily Cadherin-like 6.67e-31
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 1126-1255
Classification Level Classification E-value
Superfamily Cadherin-like 9.82e-31
Family Cadherin 0.0016
Further Details:      
 
Domain Number 5 Region: 3118-3221
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-29
Family Cadherin 0.00044
Further Details:      
 
Domain Number 6 Region: 2275-2381
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 1019-1137
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-28
Family Cadherin 0.00065
Further Details:      
 
Domain Number 8 Region: 1555-1656
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-27
Family Cadherin 0.00086
Further Details:      
 
Domain Number 9 Region: 2802-2910
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-26
Family Cadherin 0.0015
Further Details:      
 
Domain Number 10 Region: 3016-3124
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-26
Family Cadherin 0.00062
Further Details:      
 
Domain Number 11 Region: 1758-1878
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-26
Family Cadherin 0.0015
Further Details:      
 
Domain Number 12 Region: 137-259
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-25
Family Cadherin 0.0014
Further Details:      
 
Domain Number 13 Region: 816-918
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-24
Family Cadherin 0.001
Further Details:      
 
Domain Number 14 Region: 2068-2175
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-23
Family Cadherin 0.0025
Further Details:      
 
Domain Number 15 Region: 709-814
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-23
Family Cadherin 0.0012
Further Details:      
 
Domain Number 16 Region: 2911-3022
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 17 Region: 920-1023
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-22
Family Cadherin 0.0025
Further Details:      
 
Domain Number 18 Region: 3432-3536
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-22
Family Cadherin 0.0022
Further Details:      
 
Domain Number 19 Region: 2175-2282
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 20 Region: 1449-1553
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-21
Family Cadherin 0.0012
Further Details:      
 
Domain Number 21 Region: 457-558
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-21
Family Cadherin 0.001
Further Details:      
 
Domain Number 22 Region: 1659-1782
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-21
Family Cadherin 0.002
Further Details:      
 
Domain Number 23 Region: 2583-2693
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-20
Family Cadherin 0.0011
Further Details:      
 
Domain Number 24 Region: 2382-2482
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-19
Family Cadherin 0.0016
Further Details:      
 
Domain Number 25 Region: 2485-2595
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-19
Family Cadherin 0.0023
Further Details:      
 
Domain Number 26 Region: 1356-1455
Classification Level Classification E-value
Superfamily Cadherin-like 1.15e-17
Family Cadherin 0.0072
Further Details:      
 
Domain Number 27 Region: 1871-1968
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-17
Family Cadherin 0.004
Further Details:      
 
Domain Number 28 Region: 1232-1346
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-17
Family Cadherin 0.004
Further Details:      
 
Domain Number 29 Region: 562-663
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000055
Family Cadherin 0.0035
Further Details:      
 
Domain Number 30 Region: 1977-2080
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000457
Family Cadherin 0.0017
Further Details:      
 
Domain Number 31 Region: 2701-2800
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000123
Family Cadherin 0.0042
Further Details:      
 
Domain Number 32 Region: 366-463
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000101
Family Cadherin 0.0036
Further Details:      
 
Domain Number 33 Region: 4126-4163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000223
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 34 Region: 3542-3631
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000714
Family Cadherin 0.0092
Further Details:      
 
Domain Number 35 Region: 4091-4130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family EGF-type module 0.016
Further Details:      
 
Domain Number 36 Region: 33-149
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000642
Family Cadherin 0.0066
Further Details:      
 
Domain Number 37 Region: 4052-4088
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000151
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 38 Region: 4013-4052
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000336
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000007459
Domain Number - Region: 273-352
Classification Level Classification E-value
Superfamily Cadherin-like 0.000157
Family Cadherin 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007459   Gene: ENSSSCG00000007000   Transcript: ENSSSCT00000007666
Sequence length 4587
Comment pep:known_by_projection chromosome:Sscrofa10.2:17:9339790:9455277:1 gene:ENSSSCG00000007000 transcript:ENSSSCT00000007666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRHLASRLLLLLLLQHFRDSDGSQTLDHSPIQFTHFQYNVTVHENSAAKTYVGHPVKMG
IYITNPLWELRYKIVSGDNENLFKAEEYILGDFCFLRIRTKGGNTAILNREVKDHYTLIV
KAVEKTTNAEARTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGT
NGEFYYSFKDRTDMFAIHPTSGAVVLTGRLDYTEAKLYELEILAVDRGMKLYGSSGISSM
AKLTVHIEQANACPPVITAVTLAPSELDKDPTYAIVTVEDCDQGANGEIASLSIVAGDLL
QQFRTVRASPGSKEYKLKAVGGIDWDSHPFGYNLTLQAKDKGTPPQFSSVKVIHVASPQF
KAGPVRFEKEVYRAEISEFAPSSTPVVMVKATPSYSHLRYVFKSTPGKAKFSINPNTGLI
SILEPIKRQQASHFELEVTTSDRKASTRVLVKVLSANSHPPEFTQTAYRASFDENVPIGT
TVMSVSAVDPDEGENGYVTYSIANVNHVPFVIDHFSGAVSTSENLDYELMPRVYTLRIRA
SDWGLPYRREVEILATVTLNNLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDADELQ
LVRYQIEAGNELDLFSLNPTSGVLSLKQSLMDGFGAKVSFHSLRITATDGENFATPLYIN
ITVAALRKPVNLQCEETGVAKMLAEKLLQANKLHSQGEAEDVFFDSHSVNAHAPQFRSTL
PAGIEVKENRPVGSSVIFMNATDLDTGFNGKLVYAISGGNEDSCFIIDMETGVLKILSPL
DRETTDRYSLNITVSDLGLPQKAAWRLLEIRVLDANDNPPEFLQESYFVEVSEDKEINSE
IIPVEATDKDLGPNGHVMYSIPTDTDFSIDSMTGVVKIVNPLDREEQHVHYLKIEARDQA
REEPQLLSTVLLKVSLEDVNDNPPKFIPPNYRVKVREDLSRRNHNHVLEAYEPDLGQSSQ
VRYSLLDAGEGTFEVDKLSGAVRIVQQLDFEKKQVYNLTVRAKDKGKPISLSSTCYVEVE
VIDVNENLHPPVFPSFVEKGAVKENVPIGSSVMKVSAHDEDTGRDGEIHYSIRDGSGVGV
FKIDEETGVIETSDRLDRESTSHYWLTIYASDQGVVPLSSFVEVYIEVEDVNDNAPQTSE
PVYYPEIMENSPKDVSVVQIEAFDPDSSSDDKLTYKITSGNPQGFFSISPKTGLITTTSR
KLDREQQDEHILEVTVTDNGSPPKSTIARVIVKILDENDNKPQFLQKFYKIRLPEREKPE
RERSSKREPLYRVIATDKDEGPNAEISYSIEEGNEHGKFFIEPKTGVVLSKKFSAAGEYD
ILSIKAVDNGRPQKSSTTRLHIEWISKPKPSLEPIAFEESFFTFTVMESDPVAHMIGVIT
VEPPGIPLWFDIIGGNYDSHFDVDKGTGTIIIAKPLDAEQKSNYNLTVEATDGTTTILTQ
VFIKVIDTNDHRPQFSTSKYEVVIPEDTVPETEILQISAMDKDEKNKLIYTLQSSIDPLS
LKKFRLDPATGSLYTSEKLDHEAIHQHVLTVMVRDQDVPVKRNFARIIVNVSDTNDHAPW
FTSSSYEGRVYESAAIGSVVLQVTALDKDKGKNAEVLYSIESGNIGNSFTIDPILGSIKT
AKELDRSKQVEYDLMVKATDKGNPPMSEMTSVRIFVTIADNASPKFTSKEYSFEISETIS
IGSFVGMVTAHSQSSVIYEIKDGNIADAFDINPHSGSIITQKALDFETLPVYTLTIQGTN
MAGLSTNTTVLVHLQDENDNSPVFMQSEYTGLVSESASINSVVLTDRNVPLVIRATDADK
ESNALLVYHIVEPSIHKYFAIDSSTGAIHTVLSLDYEETSTFHFTVQVHDMGIPRLFAEY
AANVTIHVIDINDCPPVFSKSLYEASLLLPTYKGVKVITVNATDADSSAFSQLMYSITEG
NIGEKFSMDPKTGTVTVQNTTHLRSRYELTVRASDGRFASFTSVKINVRESKESQLKFTQ
DFYSATVKENSTEAKTLAVITAIGNPINEPLFYHILNPDRRFKISRTSGVLSTTGIPFDR
EQLETFDVVVEVTQERKPSAVAHVVVKVVIEDQNDNAPVFVNLPYYAVVKVDTAVGQIIR
YVTAIDRDSGRNGEVHYYLKEHHEHFQIGSSGEISLKKPFEPDTLNKEYLITVVAKDGGS
PAFSAEVIVPITVMNKAMPVFEKPFYSAEIPENIQVHSPVVHVQANSPEGLKVFYSITDG
DPFSQFTINFNTGVINVIAPLDFESHPAYKLSIRATDSLTGAHAEVFVDIVVEDINDNPP
VFVQQSYAATLSEATVIGTSVVQVRATDSDSEPNRGISYHMFGNHSKSHDHFHIDSSTGL
ISLVRTLDYEQFQQHKIFVRAVDGGMPPLSSEVIVTVDVTDLNDHSPLFDQPVYEAKISE
HAAHGHFVTCVKAYDADSSDIDKLEYSILSGNDHKNFVVDGRTGIITLANLRRQALKPSY
TLQVSVSDGVFRSSAQVRVTVIGGNLHSPVFLQNEYEVELAENAPLHTLVTEVKATDGDS
GIYGQVTYHIINDFAKDRFYTNERGQIFTLEKLDRETPAEKVIPIRFMAKDAGGKVAFCT
INVILTDDNDNAPQFRATKFEVNIGSNVPKGTSVIKVLASDADEGSNADVTYAIEADSEN
VKENLEINRLSGIITTKESLVGLENEVFTFFVRAVDNGSPPKESVVPVYVKVLPPELRLP
RFSEPFYTYTVSEDVPIGTEIDLIRAEHSGTVLYSLVKGNTPESNRDEFFVIDKQSGRLK
LEKSLDHEATKWYQFSVLARCSHDDYEVVASVDVSIQVKDANDNSPVLESNPYEAFIVEN
LPAGSRVIQIRASDLDSGTNGQVMYNLDQSQSVEVIESFAINMETGWITTLKELDHEKRD
RYQIKVVASDLGEKVQLSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPPGGVIAILS
TTDADSEEINRQVTYYITGGDPLGQFAVENIQNEWKVYVKKPLDREKRDNYLLTITATDG
TFSSKAIVEVKVLDANDNSPICEKTLYSDMIPEDAFPGKLIMQVSATDADIRSNAEITYT
LFGPGAEKFKLNPDTGELKTSAPLDREEQATYNLLVKATDGGGRFCQANIVLTLEDVNDN
APEFSADPYTITVFENTEPGTLLTRVQATDADAGLNRKISYSLIDSADGQFSINEVSGII
QLEKPLDRELQAVYTLSLKAVDHGLPRRLTATGTVVVSVLDINDNPPVFEYREYGATVSE
DVLIGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAIFIIENLDYESSHEY
YLTVEATDGGTPSLSDVATVNINVTDINDNTPVFSQDTYTAVISEDAVLEQSVITVMADD
ADGPSNSHIHYSIIDGNQGSPFTIDPARGEVKVTRLLDREAVSGYTLTVQASDNGSPPRV
NTTTVNIDVSDINDNAPVFSKGNHSVIIQENKPVGSSVLQLVVTDRDSSHNGPPFFFSIV
SGNEEGTFEVNQQGALLTSAAINRKVKDHYLLHVKVADNGKPPLSSLTYIDIRVIEESVY
PPAILPLEVFITAVGEEYAGGVIGKIHATDQDVYDTLTYSLDPQMDTLFSVSSTGGKLIA
HKKLDIGQYLLNVSVTDGRFTTAADITVHVRQVTQEMLNQTVAVRFANLTPEDFVGDYWR
NFQRALRNVLGVRRHDIQIVSLQPADPHPHLDVLLFVEKAGSSQVSTRQLLHKMNASVTD
LEEIIGVRILDVFQKLCAGLDCPWKFCDEKVSVDENVMSTHSTARLSFVTPRHRRTAMCL
CKEGKCPVVHHGCEDSPCPEGSECVSDPLEEKYTCVCPGGKFGQCPGSSSVTFTGNSFVK
YRLMENENKLEMKLTMRLRTYSSHAVVMYARGTDYSILEIHSGRLQYKFDCGSGPGIVSV
QSIQVNDGLWHAVSLEVNGNYARLVLDQVHTASGTAPGTLKTLNLDNHVFFGGHIRQQGS
RHGRSPQVGNGFRGCMDSIYLNGQELPLNNKPRSYAHIEESVDVSPGCLLTATEDCSSSP
CQNGGVCNPSPTGGYYCKCSALYIGPYCEVSVNPCSSNPCLYGGTCIVDNGDFICQCRGL
YTGQRCQLSPYCKDEPCKNGGTCFDSLDGAVCQCDSGFRGERCQSDVDECAGNPCHNGAL
CENTYGSYHCNCSHEYRGRHCEDVAPNQYVSTPWNIGLAEGIGIVVFITGIFLLVVVFVF
CRKMISRKKKHQPEPEDKHLGPGAAFLQRPYFDSKLNKNIYSDIPPQVPVRPISYTPSIP
SDSRNNLDRNSFEGSAIPEHPEFSTFNPESVHGHRKAVAVCSVAPNLPPPPPSNSPSDSD
SIQKPNWDFDYDTKVVDLDPCLSKKPLEEKPSHPCSARESLSEVQSLSSFQSESCDDNGY
HWDTSDWMPSVPLPDIQEFPNYEVIDEQTPLYSADPNAIDTDYYPGGYDIESDFPPPPED
FPAPDELPPLPPEFSDQFESIHPPRDMPAAGSLGSSSRNRQRFNLNQYLPNFYPVDMSEP
HKAGPGENSTRREPYAAYPPGYQRTFEAPTVENLPMSTYASTASCSDVSACCEVESEVMM
SDYESGDDGHLEEVTIPPLDSRQHTEV
Download sequence
Identical sequences ENSSSCP00000007459 ENSSSCP00000007459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]