SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007494 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007494
Domain Number 1 Region: 298-560
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.4e-86
Family Eukaryotic proteases 0.00000000215
Further Details:      
 
Domain Number 2 Region: 105-210
Classification Level Classification E-value
Superfamily Kringle-like 1.52e-31
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 3 Region: 213-299
Classification Level Classification E-value
Superfamily Kringle-like 7.97e-31
Family Kringle modules 0.0000447
Further Details:      
 
Domain Number 4 Region: 36-85
Classification Level Classification E-value
Superfamily FnI-like domain 4.87e-20
Family Fibronectin type I module 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007494   Gene: ENSSSCG00000007032   Transcript: ENSSSCT00000007701
Sequence length 562
Comment pep:known_by_projection chromosome:Sscrofa10.2:17:13168731:13197225:-1 gene:ENSSSCG00000007032 transcript:ENSSSCT00000007701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYALKRELWCVLLLCGAICTSPSQETHRRLRRGVRSYRVTCRDEKTQMIYQQHQSWLRPL
LRGNRVEHCWCNDGQTQCHSVPVKSCSEPRCFNGGTCLQAVYFSDFVCQCPVGFIGRQCE
IDARATCYEDQGITYRGTWSTTESGAECVNWNTSGLASMPYNGRRPDAVKLGLGNHNYCR
NPDKDSKPWCYIFKAEKYSPDFCSTPACTKEKEECYTGKGLDYRGTRSLTMSGAFCLPWN
SLVLMGKIYTAWNSNAQTLGLGKHNYCRNPDGDTQPWCHVLKDHKLTWEYCDLPQCVTCG
LRQYKEPQFRIKGGLYADITSHPWQAAIFVKNRRSPGERFLCGGILISSCWVLSAAHCFQ
ERFPPHHVRVVLGRTYRLVPGEEEQAFEVEKYIVHKEFNDDTYDNDIALLQLKSDSLTCA
QESDAVRTVCLPEADLQLPDWTECELSGYGKHEASSPFYSERLKEAHVRLYPSSRCTSKH
LFNKTITNNMLCAGDTRSGGDNANLHDACQGDSGGPLVCMKGNHMTLVGVISWGLGCGQK
DVPGVYTKVTNYLNWIRDNTRP
Download sequence
Identical sequences 9823.ENSSSCP00000007494 ENSSSCP00000007494 ENSSSCP00000007494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]