SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007497 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007497
Domain Number 1 Region: 2-289
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.94e-78
Family Arylamine N-acetyltransferase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007497   Gene: ENSSSCG00000025799   Transcript: ENSSSCT00000007704
Sequence length 290
Comment pep:known chromosome:Sscrofa10.2:17:14243941:14244810:-1 gene:ENSSSCG00000025799 transcript:ENSSSCT00000007704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INIEAYFERIGYKNWQNKLDLQTLTDIFQHQIRAIPFENLNIHCGEATELSLEAIFDQVV
RKKRGGWCLQLNYLLYWALSTIGFKATLLGGWIYIAPVKKYSNAMVHLLMKVTIDDRNYI
VDAGYPGSSQTWQPLELISGKDQPQVPSIFRLTEEKGIWYLDQIRREEFIPNEEFINSDL
LQKNKYQKIFSFTLEPRSLKDFESVNAYVQESPTSVFTDKSFCSLQTPEGVHFLVGFTLT
YRRYNYKDNMDLVEFKTLNEEEIEENLKNIFNISLEKKLVPKNGDQFFTI
Download sequence
Identical sequences F1SE17
9823.ENSSSCP00000007497 ENSSSCP00000007497 ENSSSCP00000007497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]