SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007498 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007498
Domain Number 1 Region: 1-289
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.7e-84
Family Arylamine N-acetyltransferase 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007498   Gene: ENSSSCG00000026893   Transcript: ENSSSCT00000007705
Sequence length 290
Comment pep:known chromosome:Sscrofa10.2:17:14206994:14216749:-1 gene:ENSSSCG00000026893 transcript:ENSSSCT00000007705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIEAYFKRIGYKNWKNKLDLETLTDILQHQIRAIPFENLNIHCGEAMELDLEAIFDQIV
RRNRGGWCLQVNHLLYWALTTIGFETTILGGYVYNTFADKYSNAMIHLLLKVAIDGREYI
VDAGFGRSYQMWQPLELISGKDQPQVPCIFRLREEEGIWYLDQIRREQYIANEEFLNSDL
LEMNNYRKIYSFTLEPRTIEDFESVNIYLQESPASVFTSKSFCSLQTPEGVHCLVGFTLT
YRRFNYKDNMDLVEFKTLKVEEIEEELKSIFNISLEKKLVPKHGDRFFTI
Download sequence
Identical sequences A0A287AJE4
XP_003134284.1.46622 ENSSSCP00000007498 9823.ENSSSCP00000007498 ENSSSCP00000007498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]