SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007532 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007532
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-34
Family SPRY domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007532   Gene: ENSSSCG00000023543   Transcript: ENSSSCT00000007741
Sequence length 125
Comment pep:known chromosome:Sscrofa10.2:1:314536081:314536458:1 gene:ENSSSCG00000023543 transcript:ENSSSCT00000007741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSWDLGICRDNVTREGVFTMSPQNGFWAIRLYDGDYWALTSPETSLPLRERPLKVGIFL
DYEAGDVSFYNMTDGSHIFTFPQNTFYGVLRPLFRLWSSDSGSLNICSAEGECTDVIHKS
TLQVK
Download sequence
Identical sequences ENSSSCP00000007532 ENSSSCP00000007532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]