SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007535 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007535
Domain Number 1 Region: 221-261
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000068
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007535   Gene: ENSSSCG00000007073   Transcript: ENSSSCT00000007744
Sequence length 464
Comment pep:known_by_projection chromosome:Sscrofa10.2:17:24519068:24603663:1 gene:ENSSSCG00000007073 transcript:ENSSSCT00000007744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLAAELLLLLGLLLLTLHITVLRGSGATDGRDATAANASRTQLQNNLNVESASTSETS
SPLSKEAPGKHLDHQAAHQPFPRQKFQQEAGHPSLQRDGPRSFLLDLPNFPDLSKADING
QNPNIQVTIEVVDGPDSEADKDQHPENKPSWSVPSPDWRAWWQRSLSLARANSGDQDYKY
DSTSDDSNFLNPPGGWDHPAPGHRTFETKEQPEYDSTDGEGDWSLWSVCSVTCGNGNQKR
TRSCGYACTATESRTCDRPNCPGIEDTFRTAATEVSLLAGSEEFNATKLFEVDTDSCERW
MSCKSDFLKKYMHKVINDLPSCPCSYPTEVAYSTADIFDRIKRKDFRWKDASGPKEKLEI
YKPTARYCIRSMLSLESTTLAAQHCCYGDNMQLITRGKGAGTPNLISTEFSAELHYKVDI
LPWIICKGDWSRYNEARPPNNGQKCTESPSDEDYIKQFQEAREY
Download sequence
Identical sequences F1SBJ6
ENSSSCP00000007535 ENSSSCP00000007535 9823.ENSSSCP00000007535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]