SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007561 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007561
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily DTD-like 3.66e-54
Family DTD-like 0.0000695
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007561   Gene: ENSSSCG00000007098   Transcript: ENSSSCT00000007770
Sequence length 209
Comment pep:known_by_projection chromosome:Sscrofa10.2:17:30300695:30435498:1 gene:ENSSSCG00000007098 transcript:ENSSSCT00000007770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDEGG
RHWAKSVMDKQYEVLCVSQFTLQCVLKGNKPDFHLAMPSEQAEGFYNSFLEQLRKAYRPE
LIKDGKFGAYMQVHIQNDGPVTIELESPAPGAATSDPKQLSKLEKQQQRKEKTRAKGPSE
SSKERSTPRKEDRSASSGAEGDVSSEREP
Download sequence
Identical sequences F1SBH1
ENSSSCP00000007561 ENSSSCP00000007561 XP_003134325.3.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]