SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007578 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007578
Domain Number 1 Region: 23-174
Classification Level Classification E-value
Superfamily C-type lectin-like 1.33e-17
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 2 Region: 405-444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000552
Family EGF-type module 0.00048
Further Details:      
 
Domain Number 3 Region: 243-369
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000518
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 441-479
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000108
Family EGF-type module 0.0025
Further Details:      
 
Domain Number 5 Region: 365-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000559
Family EGF-type module 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007578   Gene: ENSSSCG00000007115   Transcript: ENSSSCT00000007787
Sequence length 579
Comment pep:known_by_projection chromosome:Sscrofa10.2:17:34274132:34277761:-1 gene:ENSSSCG00000007115 transcript:ENSSSCT00000007787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRVLLLGVLAPAGLGFPVLPEAQPLGSQCVEHDCFALFRGPATFLAASQACEHLQGHLM
TVRSSVAAEVISLLLSGEGDGPRLWIGLQLPRDCVEPRHRGALRGFQWVTGDNHTSYSMW
ARPQGDEEPICGTLCVAVSAAGAPVPGEPAWEEQQCEAEADGFLCEFHFPASCQPLAVKS
DAAEAASFSITYSTPFGARGADFQALPVGSSVAVTPLGVELECAVWPGEAQARWVREAPG
AWACGVENGGCQHACNGSAGESRCLCPADAALQEDGRSCEAPAEHPCHRLCEHICFHDPL
DAPTNYTCFCEAGYRLAADGHRCEDVDDCAEVPSPCPQSCVNTQGGFQCHCLPNYELVDG
ECVEPVDPCFGTDCEYECQVVGRTGYRCVCAEGFAPVPHAPHRCQMFCNQTSCPADCDPN
KQDSCQCPDGYILDEGSICTDIDECNNGYCPGECRNLPGTYECICGPQLDLAGHAGTDCD
PIQENSREQGGGDEDVGSGEPAVSPTPGTTARPSPARPLHSGVLAGISIATLSLVVALLA
LLCHLRKKQGTSRAELEYKCGVPAKEVVLQHVGQMPQKL
Download sequence
Identical sequences F1SAT9
9823.ENSSSCP00000007578 ENSSSCP00000007578 ENSSSCP00000007578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]