SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007579 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007579
Domain Number 1 Region: 29-189
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-20
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 2 Region: 254-382
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 3 Region: 377-465
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000115
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007579   Gene: ENSSSCG00000007116   Transcript: ENSSSCT00000007788
Sequence length 646
Comment pep:known_by_projection chromosome:Sscrofa10.2:17:34381626:34384902:1 gene:ENSSSCG00000007116 transcript:ENSSSCT00000007788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSPGLLLLLLLLLVQPREGATSQEAVVCVGTACYSAHWGKLSADEAQLHCDKKGGNLA
TLKSEEEARHVQGTLAQLLQPGAPLAERMGRFWIGLQRDKGKCLDSDLPLKGFRWVDGVE
DTPYTNWHKEAKNSCISKRCVSLLLDLSTPALASRLSKWAEGPCGSSRSPGNSVEGFVCK
FSFKGMCRPLALGGPGQVTYTTPFQATSSTLQAVPFGSMAHVACGDRDESQQPYFLCKEK
APNVFEWNSSGPLCISPKLGCDFNNGGCEQDCFEGGDGSFRCGCRPGYRLLDDLVSCASR
NPCSSSPCRGGATCVPVQLGKDFRCHCPPGYQLDLTGRDCVDVDECQDAPCTQECVNTPG
SFRCECWVGYEPGGPGEGACQDVDECAPGRSPCAQGCTNTIGSFSCSCEDGYILAGEEGT
QCLDLDECEGQGARRCGGLCLNTEGSFRCGCLPGWELAPDGVSCTGGPTSPAPSAGTPQV
QDTGDGEGEHVSSATASSPTGDPEGTSETTWVVPTTGRSSLPRHVRTSLAPPEMLVPSGT
RSVWSPVGPLATPGQRESTGDDFTAKHSDSGTDGQKLLLFYILGTVVAILLLLALALGLL
VYRKRRAKREEKEKPKNAADSYAWVPERAESRAAENPYSPTPGTDC
Download sequence
Identical sequences F1SAT8
XP_003359965.2.46622 ENSSSCP00000007579 ENSSSCP00000007579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]