SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007654 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007654
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily FKBP-like 1.26e-42
Family FKBP immunophilin/proline isomerase 0.00000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007654   Gene: ENSSSCG00000007188   Transcript: ENSSSCT00000007865
Sequence length 108
Comment pep:novel chromosome:Sscrofa10.2:17:38470180:38495437:-1 gene:ENSSSCG00000007188 transcript:ENSSSCT00000007865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLVFDVELLKLE
Download sequence
Identical sequences A0A250Y8Z2 Q2VTP6
ENSSSCP00000007654 ENSSSCP00000007654 NP_001033089.1.46622 XP_004272710.1.21590 XP_004323073.1.83887 XP_007465432.1.90284 XP_016004401.1.101085 XP_016004402.1.101085 XP_020031838.1.5219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]