SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007874 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007874
Domain Number 1 Region: 345-571
Classification Level Classification E-value
Superfamily vWA-like 1.04e-60
Family Integrin A (or I) domain 0.00031
Further Details:      
 
Domain Number 2 Region: 9-218
Classification Level Classification E-value
Superfamily vWA-like 7.51e-56
Family Integrin A (or I) domain 0.00028
Further Details:      
 
Domain Number 3 Region: 219-341
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000157
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 4 Region: 581-623
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.000000955
Family Chicken cartilage matrix protein 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007874   Gene: ENSSSCG00000007391   Transcript: ENSSSCT00000008090
Sequence length 627
Comment pep:known_by_projection chromosome:Sscrofa10.2:17:53223744:53233619:-1 gene:ENSSSCG00000007391 transcript:ENSSSCT00000008090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLLGLLLPLLLLLLQPWETQLQFAGPRCRTGPLDLVFVIDSSRSVRPFEFETMRQFLV
GLLRSLDVGPNATRVGVIQYSSQVQSVFPLGAFSRREDMEGAIRALVPLAQGTMTGLAIQ
YAMNVAFSVAEGARPPEARVPRVAVIVTDGRPQDRVAEVAAQARARGIEIYAVGVQRADV
GSLRAMASPPLDEHVFLVESFDLIQEFGQQFQGRLCREKDLCAEGGHGCQHQCVSAPGTF
HCACNPGYRLAADNKSCLAINLCAEETHGCEHHCVSSPGSYFCRCRAGFVLQQDQRSCRA
IDYCSFGNHSCQHECVNTFGGPRCRCREGHDLLPDGRSCQARDLCNGVDHGCEFQCVSEG
LSYRCLCPEGQQLLADGKSCNRCREGHVDLVLLVDGSKSVRPQNFELVKRFVNQIVDFLD
VSPEGTRVGLVQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSF
SEAQGARPRALNVPRVGLVFTDGRSQDDVSVWAARAKEEGIVMYAVGVGKAVEEELREIA
SEPAELHVSYSPDFSTMTHLLENLKGSICPEEGIGAGTELRSPCECDSLVEFQGRTLGAL
ESLSQNHSLAQLTARLEELENQLAAQK
Download sequence
Identical sequences ENSSSCP00000007874 ENSSSCP00000007874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]